CAZyme Information: KAA8911609.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8911609.1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	SWFS01000277|CGC1	74252.19	4.6643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000277:83998-85977(-)

Full Sequence      

MFVHPLRFGASLVPLLGILLQSLQGVQGAPHDPSSYLSRRDQSDLRNYRILSDGTGSARV
DEQGDPLPGVRVPRKEKFPVDNVRKLPNGSSGKLRKVQSSKKHPADEKRRNIVKEAFKTS
WNQYSKHAWGKDEIKPVSNQSSNPFTGWAATMVDSLDTLKIMGLDDEFEKAVDFVGSIDF
TATFREDIPLFETWIRYLGGLISAYDLSGKQVLLEQAKVLADNLIGAFDTPNRMPITFYK
WQDNDSKLNFLAGTNAGVAEIGTLTLEFVRLAQLTKDDRYYDAVDRITDKFIDFSKSKSL
IRGLLPGNVDISGCNMTFTSDDENAKDDLVTLEDVRGGNSSKKERDSTGDLVPVLVAADD
QGNYRRAHCKPQDMEFVPNEDTASYNFDGGTDSAYEYFMKTYQLLNGAEDKYKQLYLDII
EPAKKYILFKPKVRNNNGILLLGSQTVSKNGTMTPHYGMQHLTCFAGGMFALGGKLLDRP
EDLDIAERVTQGCVWAYNITNTGVMPDSFTVDTCPGDDWDTECTFDELQNVRRDDNVHDK
PPEFVSITQNYYLRPEAIESVFYMWRVTGDKKWREQGWKMIESVLNLTDVQDDSGQVVGY
SGVKDVTDNTGNKDNLADVEESFWMAETLKYSYLLFDDFSSVSLDDYVFNTEAHPFKLD

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	116	657	1e-156	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	116	658	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.42e-121	106	658	69	518	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	1.75e-05	145	287	409	563	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB13597.1|GH47	5.40e-187	48	658	266	938
CAG81253.1|GH47	5.42e-139	28	657	81	772
AOW04352.1|GH47	7.63e-139	28	657	81	772
QNP97983.1|GH47	7.63e-139	28	657	81	772
AEO60003.1|GH47	2.30e-131	24	657	100	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	6.55e-60	105	658	1	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.47e-59	105	658	36	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KKB_A	2.94e-59	102	658	12	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	3.61e-59	102	658	10	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
1X9D_A	4.56e-56	27	658	28	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C512|MNS1_ARATH	5.46e-74	88	658	74	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|D4AV26|MNS1B_ARTBC	9.63e-69	105	658	36	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	1.11e-67	90	658	82	537	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q12563|MNS1B_ASPPH	8.12e-62	107	658	40	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|Q2ULB2|MNS1B_ASPOR	5.44e-61	105	658	36	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999715	CS pos: 28-29. Pr: 0.9717

TMHMM  Annotations     

There is no transmembrane helices in KAA8911609.1.