CAZyme Information: KAA8911364.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8911364.1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843		96243.96	4.8820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000286:7548-10079(+)

Full Sequence      

MSLNNVVTLKGWSWRKADDGEWTRCAHDKPTTEIFTDLLDAKKIPHPFLDRNERVVQWVG
LEDWEYSTEFEYKSQQGNSTQDLVFEGLDTIATVYLNDQEILYSDNMFHIHRINVNGKLK
EGRNSLRIVFKSAFKHGKALEEKYGEMNAFNGDHSRVYVRKAQYHYGWDWGPVLMTCGPY
KEVRLESYAKAISDVFVDPVLNDDLSKATVNVNVTALGEAAGGVIDVTLESPSGKKYAGS
CSFEDGKAQIEVDSPELWNVRGHGAQNRYNVSVQLKDKSGSVLDQWKQLVGIRKVELVQE
KLQDSEGTSFYFRVNNIPVYSAGSDWIPAHNFLTALTKEDYLKWIQLAVDSNQVMIRVWG
GGIYEPDLFYEACDEYGIMIWQDFMFGCGQYPYYKEFKESVIREAEDQVRRLRNFCCMTV
YAGNNEDYQVAEQSGLEWNPSDTNGDYTNTNFPARTAYETDLPAAVEKLSPQVPYHPGSP
WGGKDTTDPTVGDIHQWNVWHGSQEKYQFWSWLGGRFISEFGMLACPSRKTVEQFVTDPI
QRYPQSRVMESHCKADGFERRLALYVMENITVRSMNLDDWIYATQLIQSECIAYAYRCWR
REWRGDGKRYIGGALVWQINDCYPVSSWAIVDFYGREKLAYYALKRESAPLGLGIYRCDV
EKKGQPLEGAQPGPPHDLRDKKYVFDVWGVNSSLKDVEGTLEVRLFDVETGKLIQELDRK
SVTLEANKTTEYLEDLAVDENTCIQARVFDSNNNLLARASDFPQPLKHSLFLNRKVKAVA
NTDSIEITTNGPVKGVVISLDNEDIKLSDNGVDVFPGDPYIIQAKGITQSDKISIRYYEQ
DAA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	733	1.9e-82	0.6835106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.42e-64	2	653	14	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	2.50e-15	685	768	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	1.00e-09	192	293	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	6.89e-06	85	378	132	392	cryptic beta-D-galactosidase subunit alpha; Reviewed
407625	Ig_mannosidase	3.98e-05	772	823	4	55	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI21799.1|GH2	0.0	8	841	7	848
ANB14378.1|GH2	0.0	7	838	12	859
QPG76551.1|GH2	1.84e-301	4	839	6	852
SGZ52529.1|GH2	3.82e-299	3	839	1	834
QOU19887.1|GH2	5.04e-299	6	838	4	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.39e-134	1	825	21	811	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	9.61e-106	34	823	41	831	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.82e-106	34	823	41	831	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.74e-105	34	823	39	829	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.89e-105	34	823	41	831	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	6.64e-228	1	837	1	851	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q5B7W2|MANBB_EMENI	1.30e-224	7	831	8	833	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|A1CGA8|MANBB_ASPCL	1.45e-215	2	831	3	835	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	8.95e-214	11	831	12	834	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	2.52e-213	11	831	12	834	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8911364.1.