CAZyme Information: KAA8910853.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8910853.1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	SWFS01000300|CGC1	59790.33	8.9082

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000300:113871-115463(+)

Full Sequence      

MNESIVRVSQVFFGWKLVLLSLLYAVPRQYDTSTHLFLTGCDANASWFWRVLAHGIEKLV
IWDSVFYANGAERGLIYEHEWAFGRGWSLLIGILTPKSLTEWDESPLKSTYYYGLTGIIL
AIASHYLATIVLYYLTKLVFSRRRDVERYACVVATLYALSPAGMFLIAGYAEAPFALASF
IGLYLRHNQYYVFSGMFFAFSCALRGNGVLWGLLFLYDLANLSIALLENITGMTIPFVSK
NKESEELFFSRKEPKGEALRGSNEQNGVEASENGNQGSSFSRTEPKGEALRGSNEQSEPE
IREADPGGLGASPQKTVPTNEQSGFIPQKAAKRTRVFNLRELGQGGSESRDTCLQQKEPR
AIVFQMVRVIAGGTLIGLMVIGLQLYPYLLFCPGRPWCEKTIPSIFGYVQSEYWNVGFMR
YWTPNNIPNFLFGGPTLYLLYRSLVYYRHERVLRPVLLVQLVVLVTALLVYHVQIITRIA
TCLPAMYWYVGSLLTSTNLTQVKMGKRVVNYFILWTMAHAILFGAFLPPA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	355	530	8.1e-53	0.48402948402948404
GT76	11	225	2.7e-42	0.5061425061425061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.58e-29	11	530	9	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.41e-18	28	530	24	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ01203.1|GT76	2.30e-72	11	530	10	357
CAG78103.1|GT76	3.23e-72	11	530	10	357
AOW07008.1|GT76	3.23e-72	11	530	10	357
QDS75123.1|GT76	4.69e-47	2	530	10	480
SGZ50461.1|GT76	1.13e-46	1	530	1	427

PDB Hits     

KAA8910853.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6C216|GPI18_YARLI	5.74e-73	11	530	10	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q6BRZ9|GPI18_DEBHA	2.66e-43	3	530	2	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	8.18e-41	2	530	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q59VN0|GPI18_CANAL	4.42e-40	7	530	4	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	8.05e-37	3	530	8	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994529	0.005485

TMHMM  Annotations     

Start	End
5	27
113	135
156	178
193	215
369	391
427	446
453	470
474	496
508	527