CAZyme Information: KAA8909446.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8909446.1
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	SWFS01000340|CGC1	91994.35	4.6579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000340:78273-80696(-)

Full Sequence      

MQRLWRGIILLCLFIGFVLSKSNDAAILNEYTRMSNASLLWGPYRSNLYFGVRPRGIPHS
LMTGLMWYNGDQVEGIHKLRHSCEQGDVMDGYGWLSYDPRLGGTEVMRDVDNHVDITTDF
VKTADDGKNWAVRVKGKPRKGFEGAKTVMIFYAGLEGKGKLDLENEVTVSGIADDVITLK
GSSPELGKFSIKVSEEGKDNKKPKSGHSVEKIRPATNSHYTSLTVPDENVWRARDIFLTF
AQDSVAALAEDFKDDNAPPAWLLYTLPNSEAQTKGRLHYVQKIFEGEFELDVLYSGTRDD
ELTSQSVTDMIDETSDVVDKKFKQAFDFKAPFNTEEFTAFGKEMFSNLAGGLSYFYGNQK
VDRAAVDMDDDEDEDSSVDKVSNVVEEGPHELLTLVPSRSFFPRGFYWDEGFELIPLLEY
DADLALEIMASWFSQVDDDGWIAREQILGLESRSKVPEQFQTQYPNVANPPTLMLLLSRI
VNKHRHFDESKNPNFFTVDSYNEGMSLGNAYISNPQLLKDYVAKVYPNLQTHYDWFRRSQ
KGAISEFDREPFSRSEAYRWRGRTKDHCLPSGLDDYPRALVPNSGELHVDLISWVGMMAR
AMKDFATVLGEEEDAAEYARVENAVIRNIEDLHWSEEDQCYCDVTVDDYDEDVKVCHKGY
VSLMPFLLKLVPPENAVDRILPLVKLIRDPEELWTSFGIRSLSASDEFYGKGENYWRGPI
WININYMILDALQYYVEESSDKAFKKEASAVYQELRQNLVSTIHNSWKSSKFAWEQYHPD
TGKGQGVKHFLGWTSLVVNIMGMPESL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	586	801	3.8e-34	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	302	803	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.52e-95	39	259	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	8.79e-10	492	735	332	551	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	1.51e-04	589	795	578	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB14481.1|GH63	0.0	20	807	52	834
QNQ00752.1|GH63	2.20e-287	35	807	20	788
AOW07198.1|GH63	2.20e-287	35	807	20	788
CAG78244.1|GH63	2.20e-287	35	807	20	788
CAG87171.2|GH63	8.68e-274	9	807	9	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.55e-218	25	806	1	805	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	8.43e-99	39	801	37	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53008|CWH41_YEAST	2.12e-216	30	802	36	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|O14255|GCS1_SCHPO	7.61e-216	15	801	18	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q80UM7|MOGS_MOUSE	2.57e-100	39	801	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q19426|MOGS1_CAEEL	4.23e-100	36	801	84	790	Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans OX=6239 GN=mogs-1 PE=1 SV=2
sp|Q13724|MOGS_HUMAN	1.05e-98	39	806	94	836	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999718	CS pos: 20-21. Pr: 0.9818

TMHMM  Annotations     

There is no transmembrane helices in KAA8909446.1.