CAZyme Information: KAA8908722.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8908722.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	SWFT01000004|CGC1	86719.44	6.6445

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000004:56285-58618(-)

Full Sequence      

MGLIRHAIKKFERLNVNHDNDKQQPLAPQQQQQQQQQQQAPQQHQPESPQQPYSRPPAPL
PPQSSSKPQSKSASAPAFKPPASSGGDAGIFGAPIATGEPPKIYTKINHAVLPRGCSHGP
NDAPLQTNNFASNLALDDQTFPVWPLPYSLWVTRDPEQIPGMAFNHTEAKQRVFGPDPQQ
NPAQYFFNPPKIKSWVFSAEGLATNATLSIANISKFSANTRFEVNGGTVEFPIVQGMGFV
TAIYKGATPVINSQVGVHHWDEVGQVGNMIKYKAVLFNEVVWSVYVSGGRLNLENPNVIK
GGFNQGFIQIARGESRAYDDTAGCWPVDVQLGGDDSTYTLSYQLSGQSSSGKTLLWTLPH
QYETLAANNDMVDAQMQLDSPVKGVMKAFVANQIKVTEQDLPRGISFDPWSERVSQPQYS
QQALDLIRAAASSEVQEDVVGMANIDSMYTSGKILDKYAHIAWVTKFVLKDDQLTATVLD
KLKKAIDIFAQNKQKFPLRYDTMWKGIVSSAEPAADFGNANYNDHHFHYGYHIHAIALVA
KVDPNYLNEYPHVREYATTLLRDVASPQADAFFPQFRSFDWYHGHSWAHGLFPSGDGKNE
ESSSEDYHCYFGMKLWAQVIGDQAMEARANLILAIMRRSINKYMLYSLDNKVEPQQFIGN
MVSGIHFENKIDYSTFFGRGSVGDEWIHGIHMLPTTPISNYMRGSKYIKEEWDRWLAPVI
DRVDDGWKGICLLNYGGYDARAAYSFFAGDNFKPHLIDNGMSRTWSLAYLAGIGGDR

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	113	769	2.4e-206	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	76	776	38	758	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	419	767	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.43e-109	109	411	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG24550.1|GH81	3.85e-294	85	773	101	783
CCE39810.1|GH81	7.06e-291	90	775	50	731
CAX41103.1|GH81	9.04e-290	53	773	15	732
CCE83132.1|GH81	6.25e-289	86	775	54	767
CCE84163.1|GH81	6.25e-289	86	775	54	767

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.83e-80	94	767	11	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.49e-80	94	767	36	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.62e-77	94	767	11	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	2.69e-26	124	702	48	612	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	2.87e-26	124	702	68	632	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12168|ENG2_YEAST	2.66e-170	54	769	21	774	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.13e-154	94	775	6	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	9.92e-152	95	772	432	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.64e-147	87	773	44	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	5.12e-147	95	773	406	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8908722.1.