CAZyme Information: KAA8907721.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8907721.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	SWFT01000019|CGC1	45884.72	6.0118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000019:63055-64260(-)

Full Sequence      

MPLQNPALEGYYVVRNFWNLYFNPRERKFTNCGPRGDCHYSHELFVLWAVAVAVQAVVDG
ARLYPELKQQIPDAIAIFQRYKNDKVKGYCACENNGGDDRDIYYDDDAQVCSAMLSAFEV
TGDKRYLDQGRELTLFLMGGWNDDPKAKTKGGMKWHITKPYLNACTTAEVAKCCLQIARH
IPNEAKSYIDFAARAIDWQLKVLQDPGDKLIRDGVQADSDKVDDMKWSYNTGTTLSCCSM
LFAATGDKHWQDRANELATAATDPNVFFYDRDYPMELRYWRDPSKFNQLLIEGLADYLLL
AKPSQEMNERVTNEVARHLKMFYTYSRDERDGLYIESFEPNTTFPWVYDNVYKKQYAGHE
KGPGMKGEDHDDHGHVTKSIMGAGSAARVFFQGARVCPQLN

Enzyme Prediction     

No EC number prediction in KAA8907721.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	41	322	2.1e-47	0.7318435754189944

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.00e-26	113	296	95	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.07e-06	140	260	127	237	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44696.1|GH76	1.52e-165	3	401	7	404
CCG25815.1|GH76	1.23e-164	3	401	7	404
CCE73401.1|GH76	4.20e-164	1	401	1	398
CCE72840.1|GH76	4.20e-164	1	401	1	398
SGZ51231.1|GH76	5.17e-164	1	400	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	6.70e-13	91	258	96	265	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	4.74e-27	15	401	19	418	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999882	0.000124

TMHMM  Annotations     

There is no transmembrane helices in KAA8907721.1.