CAZyme Information: KAA8905278.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8905278.1
• CAZy Family: GT39
• CAZyme Description: Dolichyl-phosphate-mannose--protein mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A642V0F3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718		81361.64	7.5765

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000050:426254-428410(-)

Full Sequence      

MSSEKPCPYRSFVSTRIDPERVSRASFGISDVIALLLVTLATIASRFWRINQPNAVVLDE
SHYVDLIRQYILGVFHLDVHPPLSKLIFYWIARFAGYDGSYLPPKAGERYPDDFPYVLLR
SFSASCGVATVILTYLTLRSSGCRTLIAALGSSLLVVENSITTRSRFILLDAPLLLGSAL
AIYGVKKTQLVEPFTKKWYKMLLSTGLGVWFASSTAITGVFILVWVGLVTAWQLWRYYGD
LSISVGAVTRQAVVRTGAILVLPTLLYLAVFTVHFTILDQPGVHLAKFPVEFQATLDPEV
LDSPSMVSFGSSVTFKHQQLESYLHSHDFNYVSDSNLQQVTLYDFANDVNNEWIVEGIHH
TQEGKLQQSIKPVADNSIIRLYHKGTGRYLHVSEDVRPATSENDYSKEVNCNETRGLLGN
AEYEFRIRIIETRTGNPEARHELRSGETVFQIVHKKSGCVLLGHSNRLPRWGGYQKGVIC
IDEPTIPGTLWYIESNNHPMLNNNASHATISPPPFGYLKKMTWLHWAMSLYSSGTDNDPQ
SQTPDKWPMALRGVKLYAKVNSEVFSVGNIVIYWLGTFLVTFVVAKGIIYVLSFLNPYAT
PKYAPYVREFNDTALEFVLGWAMNYFPYYFVQRELQPHHYLPALYFLILLIALFCEYLIK
QQRVVGYFLAVAILASAGMVFYKHAPLIYGSDWTEDACEAARWFSTWRWTCDNYVLEL

Enzyme Prediction     

EC	2.4.1.109:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	38	275	1.9e-51	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	1.21e-135	2	712	5	698	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.17e-56	37	278	2	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	6.63e-39	519	705	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.11e-21	325	480	13	172	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	4.72e-07	309	356	6	55	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN65834.2|GT39	1.56e-206	10	715	20	738
CAR65785.1|GT39	1.21e-195	5	715	16	741
CCE84716.1|GT39	5.57e-185	17	714	34	739
CCE83685.1|GT39	5.57e-185	17	714	34	739
QFZ28125.1|GT39	1.80e-177	10	714	20	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.21e-124	5	718	22	738	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	6.03e-75	29	707	62	751	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ACU3|PMT5_CANAL	4.37e-168	53	715	54	724	Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT5 PE=2 SV=1
sp|O74189|PMT1_CANAL	9.08e-129	10	714	44	752	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|P33775|PMT1_YEAST	1.14e-123	5	718	22	738	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1
sp|P52867|PMT5_YEAST	3.07e-111	8	717	21	733	Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT5 PE=1 SV=1
sp|O13898|PMT1_SCHPO	1.48e-75	24	718	26	721	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000038

TMHMM  Annotations     

Start	End
26	48
116	138
167	185
207	229
256	278
570	592
613	630
640	659
664	682