CAZyme Information: KAA8903632.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8903632.1
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	SWFS01000439|CGC1	73625.19	6.0777

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000439:54792-56756(+)

Full Sequence      

MIKAWYFGWWKLSAAVVFTAVTIMLVINSIDSSRGTLFYVVERRPGVPIARETVHVHRDM
PHVRSAFYEFDSHPEAEQRPQQQATSSGGSPQEKSQSQSQGQSQSQTQGQQPETSGQSQG
VNVTTRPSTATNGTSSNCPHYVDYACKKHEPYSSGPLKLPYQRPEESCRTFTSPLVEDVI
KTFNEKIDDRDLARLFENCFPNTLDTTIRWHKDDSDVPQTFVVTGDITAEWIRDAQRQLS
PYQPLAARDDKLKSLLLGAIHTQAKFVNKAPYCNAFNPPEESEIEAEDNRQNDIVFPPFD
ERYVFECKYELDSVASFLSLANEYYSATQDSSFVTSEWKEAVKNLLQVIEEQSLATFDSN
GTALPAKYSFKRKTEQSTETQSLSGEGNPVNANTGLVRSYFRPSDDATVFQFFIPANAQL
AVDAKRASKMLKESGKDSDGIADKLNEVGKRVEKGIWDYGKVHHREFGDVFAYEVDGYGS
VLNIDDANLPSLLALSDIGFVNRDNSVYQNTRKMVLSKRGNPYYLRGEYFEGIGGPHAGI
KNAWPLSHMLRIRTSDDDDEIKKSLDILKGSTAGLGLMHESVHVDVPIDINSFTRPWFAW
ANSEFGKTILDLAERKPHLIFKKNDQSPLKLSNIIQKFQNTHPNHADPKQKVLL

Enzyme Prediction     

No EC number prediction in KAA8903632.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	189	610	3.9e-158	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	189	610	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.44e-156	167	624	1	434	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB14295.1|GH125	9.93e-208	132	647	249	785
QVM13217.1|GH125	2.69e-195	138	634	38	548
SMR58294.1|GH125	7.14e-195	138	623	32	533
SMQ53852.1|GH125	1.01e-194	138	623	32	533
SMR61267.1|GH125	2.03e-194	138	623	32	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	8.02e-100	163	612	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.01e-98	163	612	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	3.64e-98	163	612	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.19e-79	175	611	11	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.86e-79	175	611	11	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.09e-189	138	624	27	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000001

TMHMM  Annotations     

Start	End
7	29