CAZyme Information: KAA8902641.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8902641.1
• CAZy Family: GT15
• CAZyme Description: Alpha-1,2-mannosyltransferase ALG11 [Source:UniProtKB/TrEMBL;Acc:A0A642UVJ7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575	SWFT01000085|CGC1	66223.00	7.9410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000085:33484-35211(-)

Full Sequence      

MWYWLFVAVGALYAVYTALASSLSRFLFVPPLEWRDKIDKVLNFPKPIYLKCGMKRSSYR
RRLILASQQPAYYTNYTNNRLKIFPGDKDNRDEFVREMTRRAPDDPRRRMIYGFFHPYAN
NGGGGERVLWQAVKATLIADDKHIAAIYVTSDAKPLEIFAKVRAKFGISVDEARCVFIYL
RRFNSWIDHWKQFTLAGQLVGSFLLGAEALFELTPDVWVDTQGLPGPYMVVGSRLRIPII
AYVHYPVLQSDMFAKLRIRRMAEVFTHGYDVAAVAKFWYWSVLYYTYMILGASVEVTLCN
GTFTYTHLKQVWRLNSSSVMEIVYPPCGEMAMPEGSDREPKTNTMVYVAQFRPEKRHDLV
VREYHRFLSQATSIKPSAIPKLVLVGSCRTESDTATLHSLKALVKELELDVEFAVDCSYE
DLQGYIARAKFGINAMWNEHFGIGVVEYIHGGAVPIVHASGGPFLDICHDSTSLEKPYYR
NTKGYFFKSEEDPDFVTSADNQRYPSLSDLLTQIVVENPSLSSDDHLDLMRQSAAKDLYK
FDDIEFNKAWVRHLTYIDAREKEYRVTRGDMEMVY

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	339	470	6.5e-18	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	5.47e-167	110	548	1	418	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
215511	PLN02949	2.65e-87	113	471	37	397	transferase, transferring glycosyl groups
406369	ALG11_N	4.22e-81	110	312	1	208	ALG11 mannosyltransferase N-terminus.
395425	Glycos_transf_1	1.14e-08	341	463	1	113	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340831	GT4_PimA-like	1.82e-08	231	472	76	310	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRG36056.1|GT4	5.06e-195	15	575	14	599
CCG24455.1|GT4	2.51e-194	1	575	23	626
QEO19606.1|GT4	4.09e-194	15	575	14	599
QWW22565.1|GT4	3.30e-193	15	575	14	599
QEL59477.1|GT4	1.88e-192	15	575	14	599

PDB Hits     

KAA8902641.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59S72|ALG11_CANAL	1.89e-192	3	575	2	609	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG11 PE=3 SV=2
sp|Q6BVB2|ALG11_DEBHA	4.89e-184	13	575	15	616	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG11 PE=3 SV=2
sp|Q6CLD6|ALG11_KLULA	2.44e-111	19	550	24	554	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG11 PE=3 SV=1
sp|Q75B12|ALG11_ASHGO	3.67e-103	25	552	39	564	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALG11 PE=3 SV=1
sp|Q6FWD1|ALG11_CANGA	4.30e-100	112	550	48	488	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984825	0.015205

TMHMM  Annotations     

Start	End
2	24