CAZyme Information: KAA8902193.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8902193.1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	SWFT01000092|CGC3	58075.64	4.4047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000092:173622-175235(-)

Full Sequence      

MKLPLVLVASHLAMVSALPMPANWLNDFFSQLGYTTNSLGHFVKVADQTQFQPQPAAAAT
TTAAQDNAVAAAADNKAAAPVTATDYNNYAVTITYTYGNTNTPNQAPTTLVQAPSSSTPP
QPQPQPQPQSQQQPQPSQPQPAAVASASAPPQPQSSSSSAPSQPQSSSSSSSFQSFDANQ
AFSGALDAVWNTFYQNGSFDDEDPKCNQGDQAPAVWPIAITGRATVESGNIDRIYKVIAN
LEDHKNPQGWFSASTAKDNDVYVDDNAQIAWVYCDAYSLTHDPNHLQTCQQLVDNIKTQQ
IDGGGIRWDLNGHYVASISTSEAGLAALRLYEHTGDASLISFAQSTLNYMETKLTDPSDG
LFIDGIDINTNTPDKGKLTYTVGVTLSVLGYLNKYTGDSQYIDKARQLAEASAAGKGAFY
NQFGVWNNRLQYVHLLYQGFADLWRLVPGQFDDFKPEVKRESEFVHQYLQVGNSNTYVDD
ATAGDKSVFAKFQASFTNAAYEPDANNFCDSNVNGQSRSQFINGGSAAQIFYAVKDL

Enzyme Prediction     

No EC number prediction in KAA8902193.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	186	468	1.9e-39	0.8072625698324022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.13e-23	260	456	88	304	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
224250	YyaL	3.00e-07	256	411	403	566	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
227170	COG4833	7.35e-06	262	465	91	299	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
271199	LanC_SerThrkinase	1.95e-04	275	448	97	284	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
271198	LanC_like	0.002	254	452	91	289	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN66915.2|GH0	1.67e-83	176	446	1	275
AOW27980.1|GH0	3.52e-80	172	537	37	411
CCE44944.1|GH0	1.85e-79	174	534	23	381
ABN64243.2|GH0	3.63e-79	181	537	54	418
CCG21685.1|GH0	5.72e-78	186	532	188	533

PDB Hits     

KAA8902193.1 has no PDB hit.

Swiss-Prot Hits     

KAA8902193.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999748	CS pos: 17-18. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in KAA8902193.1.