CAZyme Information: KAA8902123.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8902123.1
• CAZy Family: GH81
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A642UN29]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
988	SWFT01000092|CGC4	112225.45	6.0614

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000092:24591-27557(-)

Full Sequence      

MSYRPPPPDEEYLLPNEQSQNHPNHSQTSLVAPLPSYHDQGSRRPSYHDDEEYYGQNQQP
HSVFASGYDGDHSASQTNLYHSEYNPSVPYDQSFTQAPTQHSFATSYQPSYPTPPPPPSQ
PQPSGYTSHLPPPPSYPPMKDSIEYEEYEMSDPYSHTQYQPQYYNQPLFTAPPADDEDRE
WDQNIAYGDIEGDNFQLTTALPEREAVRGNDSDDDNPFESDKVVTSGVNGHLVLDCPVAT
ELLSKYPGYQPDKEQGGLSREFAYMRYTAVTCGPSNFFRNGFILRGIHCTVPRSTELMVV
ITMYNEDDILLARTLKGVFKNIKYLMSKSRSSTWGADAWKKVVVCIVSDGRSKINPRAQA
LLAALGVYQDGLARSQVNDKKVQAHVYEYTTRVGISSVEDTVKLTTDKTVPVQLLFCLKE
KNAKKINSHRWCFQGLARVLDPKVVVLLDAGTQPSGKSLYHLWKEFDRDPRVAGACGEIK
AKLQGRQILTNPLVYAQNFEYKMSNILDKPTESDFGFISVLPGAFSAYRTVALQNDVNGQ
GPLEKYFKGEFMHTSSTDLDPDDDEYELKKTLMAHEAGIFTSNMYLAEDRILCFELVAKR
GCSWLLRYVRSASAETDVPEHLAEFVLQRRRWLNGSFFAAIYSLVHFPKIWTSSHSFGRK
LMFHVEFFYQFINLVLSWFSIGSYFLVFRILTIGLTDPAMNFPPGKVLALVFLWLYVASI
VTTFVLSFGNKPTGTQRFYVVIVLFFAVVMIYMMLAAIWMAVKTITNIINDPSKSSAAAL
FSDPNFRDLIVATGSTYVLYFVASFMYLEPWHMFTSFLQYLLLSPSYVNVLNIYAFCNID
DVSWGTKGDTGAQDLGTAKAKEDGTFSVSIPVSTEEINKSYLKELDKIKTPEPAEKEKKP
VSNEDYYKYVRSMTVLVWMLTNFVIIAVVLETGGLSDFVEEDDTDNKTKRSKIFLTVILW
IVCFTALFRFIGCIWYLFSRMFKRKRTT

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	303	466	1.2e-72	0.9938650306748467
GT2	444	666	3.1e-17	0.3757115749525617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.13e-101	303	466	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.15e-84	299	639	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.88e-28	415	760	115	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	3.84e-25	228	302	5	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	6.00e-16	299	533	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86776.2|GT2	0.0	138	984	111	976
QBM90805.1|GT2	0.0	174	984	133	958
QWW24830.1|GT2	0.0	127	987	71	965
QRG39444.1|GT2	0.0	127	987	71	965
QWU89335.1|GT2	0.0	127	987	67	960

PDB Hits     

KAA8902123.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	0.0	175	981	145	997	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30583|CHSC_EMENI	2.37e-278	230	983	185	916	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30588|CHS3_NEUCR	1.63e-273	230	983	158	886	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30601|CHS2_EXODE	1.76e-272	229	981	193	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|Q12564|CHSA_AMPQU	2.32e-265	230	981	171	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
632	651
671	693
708	730
739	761
789	811
914	936
956	978