CAZyme Information: KAA8901540.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8901540.1
• CAZy Family: GH76
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A642UM56]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	SWFT01000102|CGC1	46333.71	9.5221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000102:172780-174024(-)

Full Sequence      

MATAATAFLAVKAVQLAVVYFTPSQFDTSSQIIVDTYTQARSQLLNEWHLPNAAASILDK
LIAWDAVYFNHLYVDDIDFEHEYVFCPLWWRLIKWIPLGQGNYYKKALVSIIVSNLCHWA
SIVMAIELTKVYFPASVLAKRPSLPQTVGKLYAILPAGIFLTVGYSENLANLLSLTMLWL
HQTSIGPDYRTKAKLAIISPLKYLLSGVVLAVAVGVRANMILAGVFYLFDLYQLGYLSRQ
LKTIALIIVTGAIPLLSMIGLNAVAYAAFCPQRGAWCQWPVPSLFQYAQSHYWNVGFLKY
WTPNNIPNFAFAAPTVAIHALAIKEFVSKLPVMPRFVSLIAFTAMTVAGAVFFWNTQIIT
RMVWVTPLAVWYLALQLTSPETTTPSRWTRIYIGYALVWIPLQSALFAAFLPPA

Enzyme Prediction     

No EC number prediction in KAA8901540.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	7	414	1.2e-85	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.53e-38	8	414	8	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.94e-14	62	414	75	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87189.1|GT76	2.60e-112	8	414	11	428
XP_459021.1|GT76	2.60e-112	8	414	11	428
CCE40664.1|GT76	8.82e-101	8	414	13	401
CCE83209.1|GT76	7.63e-100	11	414	14	426
CCE84240.1|GT76	7.63e-100	11	414	14	426

PDB Hits     

KAA8901540.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BRZ9|GPI18_DEBHA	4.62e-113	8	414	11	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q59VN0|GPI18_CANAL	4.10e-97	8	414	9	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|P38211|GPI18_YEAST	2.48e-50	8	414	9	433	GPI mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI18 PE=1 SV=2
sp|Q6CMW6|GPI18_KLULA	6.65e-50	8	414	17	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	1.20e-48	6	414	9	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999856	0.000176

TMHMM  Annotations     

Start	End
111	133
153	175
207	229
244	266
332	354
358	375
388	410