CAZyme Information: KAA8897267.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8897267.1
• CAZy Family: AA4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	SWFT01000158|CGC1	34100.00	4.2780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000158:37122-38048(-)

Full Sequence      

MLPTTLLTALAASVASVSALGDLAFNLGVKDNAGNCKTVQEFEDDFKRLSPYSKIVKTYA
VSDCNTLQNLGPAAEDSGFQLMLGIWPNDDAHFEAEKNALKTYLPKLSKGTIKTFLVGSE
ALYRKDMEPQDLANRISEIRDLVKDIKDKNGESYSGIPVGTVDSWNVIVDGWSYPALKEA
DVVYANAFSYWQGQTKQNSTYSFFDDIMQALQTIQNVKGSTDIDFWVGETGWPSDGSNFG
DSYPGVDNAKDFWQQGICAMRAYGVNVAVFEAQDEAWKPDESGINDVEKHWGVFDSNGKL
KYDLDCKF

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	24	306	2.4e-45	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366033	Glyco_hydro_17	3.62e-100	23	306	1	309	Glycosyl hydrolases family 17.
227625	Scw11	8.93e-92	8	297	31	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG23752.1|GH17	1.14e-167	6	308	5	307
CCE44358.1|GH17	1.33e-166	6	308	5	307
QFZ46728.1|GH17	1.42e-163	7	308	6	307
QFZ52393.1|GH17	1.42e-163	7	308	6	307
QFZ35353.1|GH17	1.42e-163	7	308	6	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.54e-38	26	301	41	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.44e-37	26	301	41	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	2.62e-157	7	308	6	307	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	5.83e-154	7	308	6	307	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	2.18e-143	5	308	9	312	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	9.94e-82	10	306	29	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	1.91e-64	4	307	5	302	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999668	CS pos: 19-20. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in KAA8897267.1.