CAZyme Information: KAA8896955.1

Basic Information

• Species: Diutina rugosa
• Lineage: Ascomycota; Saccharomycetes; ; NA; Diutina; Diutina rugosa
• CAZyme ID: KAA8896955.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451		53336.41	6.0775

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DrugosaCBS613	5819	N/A	4	5815

• Gene Location: location=SWFT01000161:107558-108913(+)

Full Sequence      

MKNLSWWSRNWEFKLGIAIAAYFLLQYFVLDSLQHHDAELASHLRVIPPAYLDQWQHINP
VSPGSKVAYVQYATTYGHINLAVINGIELRKAGTVADVVVVFDQRLRHFNHEQWNRLLTL
ARDHSITLKPVDTIRADVAEDVWQNSFTKLYAFNMTEYDRVVYFDGDSMLMKGHLDELFS
IPEEIEFASPHAYWHNHVLEKYHEKEGLGHEPSRPNVDIPVLADYIRKTTDRAQLLKGTD
ADWNLLPPLFYDDNKYGNRLDFFGTHIMVITPNTKRFNDLLRYVSTPWWWKFTKPELSHK
RNEYDMEVINKYMDQQLRHGADFKMAILPHTVYGVLTGEFLEEYHRRFVVPPQYTPFITK
ESNEEWDATDALMNVKLIHFSDAPIPKPWETYNDQMPYNTKRTFCMFDYDEAEFNSKYPV
FKPRITDDCESVEAWEGIRERFSKQMTNWVV

Enzyme Prediction     

No EC number prediction in KAA8896955.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	91	391	2.1e-17	0.7859922178988327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.65e-79	68	442	2	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	2.14e-17	68	390	2	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133018	GT8_Glycogenin	1.06e-11	67	196	1	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.76e-06	143	193	153	202	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27523.1|GT8	1.70e-131	2	449	4	459
CCG21314.1|GT8	7.38e-127	2	445	10	462
AAV04198.1|GT8	2.08e-125	8	445	5	448
ABN66322.2|GT8	6.34e-124	9	451	17	478
CCE43359.1|GT8	3.48e-122	3	445	9	462

PDB Hits     

KAA8896955.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59ZI3|GNT1_CANAL	3.01e-132	2	449	4	459	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	1.61e-101	8	444	11	456	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q4HVS2|GNT1_GIBZE	1.39e-31	65	389	153	392	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q6FQ15|GNT1_CANGA	1.98e-27	65	445	89	483	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q12096|GNT1_YEAST	6.19e-27	50	413	75	463	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

Start	End
13	30