CAZyme Information: K441DRAFT_71199-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_71199-t45_1-p1
• CAZy Family: GT69
• CAZyme Description: carbohydrate-binding module family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	KV748191|CGC4	66423.46	4.2184

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748191:1597972-1600221(-)

Full Sequence      

MRSTTFLHAVTTAAGIFASFVSATFDASAKTNVAIYWGQGSYQISLLEACQNPSVDIVNL
AFINEFPSKIGDYPGDNFANACGDTMYTKPDGTASKLRNNCPDMESHIKLCQQTYGKKVL
LSIGGAYPTNYTLATTALAEYFAEFLWGAFGPEGSSAPQSWIDAGSPRPFGSAVVDGFDF
DIETDMSSPPFSDYMSRGYADMINHFKSDLFPTASGTYYISGAPQCVVPDAHLDDAIQHS
PFDFLFVQFYNTPQCSARAGYNGLTTSTTTFTFDDWVNRVLNYGKNKGTKIYLGLPAGPD
GAPSDTAYYLNTTEANAVISKYMTKYPSTFGGVMLWEATVSANNQICCEDYAYWMKQILV
DAKAGTTFHPECSYYSSTCSVSSSSSIAPSSTSSSASSSPTPSAPLSPNGLCGPSNNGYS
CLGSGFGDCCSEWGYCGTGADYCGTGCLSSYGSCSSSNSSSSTPAITSTSSTASLKSATS
TSSSSVPSSTPTPPPSSSVPVSSSTTEAPVSSLAPVSSSTETPYSSSSSSEVPYGNSSIT
IPSTSESPVSSSTETPYSSSAPVVSSSTSESPVSSSVTSTPVRRSSQAPYGNSSNVISSS
TWESPVSSSTETPYSSSTPVVSSSASESPVSSSVTGTP

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	31	304	3.3e-22	0.6790540540540541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	6.47e-93	31	344	1	271	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395135	Chitin_bind_1	6.79e-12	412	447	2	34	Chitin recognition protein.
395573	Glyco_hydro_18	1.12e-11	32	297	1	222	Glycosyl hydrolases family 18.
211316	ChtBD1_1	2.15e-11	412	448	2	37	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211311	ChtBD1	2.63e-08	412	447	2	34	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ48369.1|GH18	4.16e-111	6	367	4	357
SMY22061.1|GH18	5.15e-111	6	367	4	357
SMR48152.1|GH18	7.27e-111	6	367	4	357
SMR49362.1|GH18	3.32e-109	6	356	4	346
CBX94753.1|GH18	1.03e-99	13	384	12	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TX6_A	9.07e-91	30	360	1	309	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XVN_A	2.45e-90	31	360	1	308	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	2.53e-90	31	360	2	309	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	1.65e-54	26	362	1	290	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
1HVQ_A	1.93e-33	33	336	3	255	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	8.63e-88	7	360	6	336	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	1.00e-86	7	360	6	336	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|A2QUQ2|CHIA1_ASPNC	8.90e-86	20	360	18	337	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|Q92223|CHIA1_EMEND	1.99e-80	18	361	16	338	Endochitinase A OS=Emericella nidulans OX=162425 GN=chiA PE=2 SV=3
sp|G5EB30|CHIA1_EMENI	1.99e-80	18	361	16	338	Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004519	0.995470	CS pos: 23-24. Pr: 0.7282

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_71199-t45_1-p1.