CAZyme Information: K441DRAFT_709536-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_709536-t45_1-p1
• CAZy Family: GT66
• CAZyme Description: glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	KV748269|CGC1	34757.02	6.2287

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748269:169674-171052(+)

Full Sequence      

MLFSHRPLGLKFLNSTALITLCALAFLYHFWGLHNRPPPAQPLLPTKIPEILWYKLGPSA
LNNQTREWTDSCIKNNPNYRSEFMTDASADAYVAKAFASRPDIVETHLGLTIPILKADIL
RYLLLLDQGGVWSDLDVSCEGIPIDEWIPAQYKSKASLVVGWEFDVGWEFAFVRQFASWT
IMAKPGLPHMSMVIEDILEGLHNKTAEHNVSLADLTLAMTGDVVDMTGPRRFTFSVLKSL
ELTLNTTVPIESISKLREPKLVGDVLIMPGYAFAASSNTYKDKEGLSPPLVTHHYAGTWK
NEDAEAKNANR

Enzyme Prediction     

No EC number prediction in K441DRAFT_709536-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	66	150	4.4e-16	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.82e-15	46	301	80	346	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.34e-09	70	149	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7026497.1|GT32	2.86e-120	6	302	4	307
CAE7002672.1|GT32	1.77e-112	3	303	13	329
QQK44540.1|GT32	7.76e-112	41	303	53	314
CBY00800.1|GT32	1.83e-105	11	302	10	314
QBZ63204.1|GT32	2.19e-103	32	302	39	320

PDB Hits     

K441DRAFT_709536-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.45e-27	48	302	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.57e-22	48	302	99	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.31e-22	47	301	129	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.73e-12	48	197	96	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.15e-06	39	140	46	144	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000001

TMHMM  Annotations     

Start	End
12	34