CAZyme Information: K441DRAFT_709109-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_709109-t45_1-p1
• CAZy Family: GT62
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	KV748253|CGC1	91612.23	5.4857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748253:62986-65584(-)

Full Sequence      

MADIDVDNALSNLTLAEKCDLLAGGEFWRTYAVPRLGIPSLCITDGADAVRGSRFFNSTP
SVCLPCGEALAATWNVELLQQLGALMGDECRVKKAHVLLSPTINIPRSPLAGRAHECFGE
DPYLSGVLAGYFCRGVQEKGIIATPKHFVCNDQEQGIFSMDCLLTQRALREIYLLPFMLA
IKLGNPGALMSAYNKVNGVHVIDSTYLLREVLRKEWKFRGLVMSDWFGMYSVCGAAEAGV
DLEMPGPGQWRGKRLAHAVAAGRIEPEVVDDRARAVLNLVKEAALSGIEGTSEETLDRPE
DRALLRKAAAESIVLMKITEGILPFDPTKPIAVIGPNAKVAAYRGGRVAHLRPYRAVSPF
EAITERSDADVLFSQGIYNHFELPLLGAQMRTQSGEVGYDMRIYAEPPEAGATRKCLNHY
ELLNSCGFFFNYHDKDLREWYIDIEGTFTPDKSGLFDFGVSVQGTANLYVDGALVVDNTT
SQKQAEGFFRNGTIEEVGSLHVEAGRTYQILCRWNHPQTSALLKDNSQTFKPGNIRLSGC
HRLDTDDSIVAAAKLASEVEQVVVLAGFVGEWESEGNDRKHMDLPPDTDRLISAVLKANP
QAAICISSGGPYSMPWLAETKALLQVWYGGNETGNAITDVLYGDTNPSGKLPLSFPMRLQ
DNPAFLCSHAERKRVLYADDIFVGYRYYDTVEREVLFPFGHGLSYTQFKITNPRASVDSD
TLLVELAIANVGTRGGMETVQVYISRESPSVKCPTKELRGFEKVDLKRDEVRQVTLHLDL
GYATGFWDEAKNRWICEEGNYTVLIGTSSRGSFERAAFRIQKTTWWTGI

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	245	5.5e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.26e-69	35	814	101	763	beta-glucosidase BglX.
224389	BglX	3.79e-67	25	340	47	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.61e-43	539	705	71	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.92e-42	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.01e-25	10	779	57	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX61249.1|GH3	2.94e-298	1	829	1	839
ATQ35958.1|GH3	2.38e-297	1	829	1	839
QQK47512.1|GH3	4.43e-296	1	828	18	847
BCS12335.1|GH3	4.93e-296	1	829	17	846
BCS00565.1|GH3	4.93e-296	1	829	17	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.66e-215	1	829	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.30e-208	5	829	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.68e-131	4	823	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.34e-111	9	810	8	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.13e-90	6	820	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	8.10e-293	1	829	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.63e-292	1	829	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.26e-292	1	829	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.74e-291	1	829	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.13e-290	1	829	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000007

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_709109-t45_1-p1.