CAZyme Information: K441DRAFT_709002-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_709002-t45_1-p1
• CAZy Family: GT62
• CAZyme Description: glycoside hydrolase family 131 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214		24110.84	5.0224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748249:285793-286836(+)

Full Sequence      

MISYAALLVLLLTQHVLVWELDRETGIVLCDGRFNEFTTSTNLNDWSWSNQRSGTEYVNL
VTSYKNPADTASKQGVKVAIDSTSKWDSDMWRMELIPQMTAAINEGHVYYHFSIKRSSTN
VPSATNEHQICFLEIVSHFTELKYDGESGTLDTNLQWMVGNTSKWTTTFEADDFSGGTVT
FWHSTGYGPLTKTADWHLGVLRLSRKGYGGTAED

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	28	213	1.4e-47	0.9137254901960784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.75e-40	28	204	1	218	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY02312.1|GH131	1.75e-79	24	214	16	240
CAE6996998.1|GH131	3.30e-79	24	214	16	240
QRC94868.1|GH131	7.07e-79	24	214	16	240
CBX90954.1|GH131	2.19e-65	26	214	21	239
EGX48793.1|CBM1|GH131	9.26e-64	26	203	17	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	2.62e-62	26	214	1	223	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	1.58e-48	26	203	1	206	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

K441DRAFT_709002-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999750	CS pos: 18-19. Pr: 0.9612

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_709002-t45_1-p1.