CAZyme Information: K441DRAFT_706412-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_706412-t45_1-p1
• CAZy Family: GT41
• CAZyme Description: glycosyltransferase family 58 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	KV748204|CGC3	42469.62	9.4193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748204:1579655-1580868(+)

Full Sequence      

MEQVEIYLTGERDYKNIEGGTGPLVYPAVHVYIYRALYALTDRGTNILLAQIIFGLVYLA
NLAVVMACYRLAKAPPYVFPLLILSKRLHSIFILRCFNDCFAVLGLFLAIYAYQRRMWTI
GSFLYTIGLNVKMTALLPLPAIGMVLLQSIGQSRAITQALIIGQMTIVYGYPFLYYYTSS
YISRAFQFTRQFLYKWTVNWRFVKEEIFLSKGFSLSLLGAHAGLLSFFTITRWTKPAQRP
FPDFINLVFNDPWDQERISRKITPQFVMXTILTANAIGMLCARSLHYQFYAYIAWTTPFL
LWRAGFHPIIQYCLWLVQEWAWNVYPSTEASSLVVVSVLAITVAGVWWGTRKDFEDVMVN
GGPQHQHTD

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	1	332	6.2e-128	0.9175824175824175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	1	332	29	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX89957.1|GT58	2.43e-161	1	367	138	506
CAE7199648.1|GT58	4.78e-161	1	357	55	412
QDS73095.1|GT58	4.49e-158	1	355	62	419
QRC96987.1|GT58	3.83e-156	1	369	50	418
AAK07848.1|GT58	6.69e-148	1	366	66	438

PDB Hits     

K441DRAFT_706412-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	1.19e-148	1	366	66	438	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	1.02e-122	1	356	50	401	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	4.75e-122	1	351	112	458	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	3.90e-116	1	346	58	399	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	7.25e-112	1	346	50	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000016

TMHMM  Annotations     

Start	End
47	69
91	113
120	142
155	177
212	234
265	287
299	318
333	350