CAZyme Information: K441DRAFT_705568-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_705568-t45_1-p1
• CAZy Family: GT4
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565		61752.82	5.0703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748196:1191305-1193419(-)

Full Sequence      

MPSEFDFIIAGGGTSGCLLANHLANAPTRPSVLLVEVGGEPVGKTVRPPFYRFMNAFTRP
DLDHGYSTTNQPLLNNRSIQYPRGKALGGSSVLNFMVYVYGSGEDYNRWGELVGDDSWRW
ENTKELFKRIENYDMAAASSYSQYANPSPSEHGQRGLVNVSLPLVLEKGTAVALDAMDKF
GMGPRNLDLNSGDPVGVGIFPSSYGRDGRTTSATAHLLNAPNNLTIWSNATVSRFILDGK
KVLGVELADGRQAMSKKDVIISAGALDSPKLLLLNGIGPADELAAHNINVVHDLPGVGKN
LRDHLLVFLPMEVDPSLTDKHAFESDTAGIAQAQEQWLKDQTGPFTLHNSTLFGGFPKLP
RLEDSAEFKALDKDLQEYLSKPTVPSYEILGNAPLALPGFQLAADSAFLTFVAFLMNPQS
QGEVTLRSTDPRDAPVIDPKYMEHPFDRKAMLETIREAVTYVQESDLKKYFKRFILGPAS
TSDEDIQEFMKEALRTGLHANGTVKMGKPEDSSACVSPDFRVYGMEGLRVVDMSVSPLTP
NNHTQTTAYLIGQKAADTIIAEYEL

Enzyme Prediction     

No EC number prediction in K441DRAFT_705568-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	561	1.5e-151	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.49e-105	1	559	2	531	choline dehydrogenase; Validated
225186	BetA	4.53e-102	1	562	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.13e-37	418	555	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.28e-36	3	553	54	570	Protein HOTHEAD
366272	GMC_oxred_N	3.68e-30	75	305	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7200393.1|AA3_2	3.91e-204	4	565	5	568
QRC97674.1|AA3_2	1.15e-200	1	565	1	565
SMR50493.1|AA3_2	1.12e-186	4	565	7	567
SMY23191.1|AA3_2	1.48e-180	4	564	7	566
SMR51427.1|AA3_2	3.34e-180	4	564	7	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.68e-74	4	562	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.83e-74	3	562	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.48e-63	1	563	35	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	1.31e-56	4	559	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.51e-56	4	559	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	5.73e-71	3	559	39	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.26e-70	5	565	2	533	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	1.16e-68	4	565	2	531	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|P18173|DHGL_DROME	5.86e-68	4	556	64	601	Glucose dehydrogenase [FAD, quinone] OS=Drosophila melanogaster OX=7227 GN=Gld PE=3 SV=3
sp|Q3L1D1|PDH1_AGABI	3.18e-67	4	563	40	593	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000002

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_705568-t45_1-p1.