CAZyme Information: K441DRAFT_701109-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_701109-t45_1-p1
• CAZy Family: GT32
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		59850.10	6.7243

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748258:113332-115056(-)

Full Sequence      

MATTTQLSPDDVNNYDFIIVGGGTAGCVIASRLSDYLPNKRVLLIEAGPSDFMDDRVLLL
KDWLNLLGGELDYDYGTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWEAQ
GCTGWSFKMFTRVLDNLRNTIQPVHERHRNQLCLDWVQSCSTACNIPIIHDFNHEIKTKG
ALKPCVGFFSVSYNPDDGRRSSASVAYIHPILHGDEKRPNLTVLTNAWVSKINVDGDSVT
GVDLTLQSGEKRTLRHKAETILCAGAVDTPRLMLLSGLGPRQQLEELGIPVVKDIPGVGE
NLLDHPETIMIWELNKPVPPNQTTMDSDAGIFLRREVPNAAGSDGEIADIMMHCYQIPFC
LNTSRLGYDTPIDAFCMTPNIPRPRSRGRLYLTSNNPLTKPALDFRYFTDPAGYDAATLV
AGLRAAREVAKAPPFAAWLKREVAPGPGVQSDEALSEYARRVAHTVYHPAGTTKMGDVER
DAMAVVDALLRVRGLRGVRVADAGVFPXMPTINPMLTVLGVGERAAELVAGAWGWRGLER
EKL

Enzyme Prediction     

No EC number prediction in K441DRAFT_701109-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	538	5.8e-88	0.5194174757281553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.86e-108	13	532	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.26e-104	15	531	6	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.35e-42	384	525	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.53e-27	13	522	54	569	Protein HOTHEAD
366272	GMC_oxred_N	1.47e-20	15	307	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7217204.1|AA3_2	0.0	1	543	1	543
QRC92500.1|AA3_2	0.0	2	543	3	543
EAA64559.1|AA3_2	0.0	1	536	1	536
BCS03844.1|AA3_2	0.0	1	536	90	625
BCS15458.1|AA3_2	0.0	1	536	1	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.17e-119	15	532	14	529	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.65e-119	15	532	14	529	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	4.64e-119	15	532	14	529	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	3.98e-57	8	531	77	638	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
4UDP_A	4.45e-57	15	529	6	527	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	6.01e-119	15	532	14	529	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.42e-71	14	532	6	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.72e-71	15	529	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	9.23e-66	15	529	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q47944|SDH_GLUOY	7.57e-64	13	531	3	529	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000006

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_701109-t45_1-p1.