CAZyme Information: K441DRAFT_699823-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_699823-t45_1-p1
• CAZy Family: GT3
• CAZyme Description: glycoside hydrolase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	KV748231|CGC1	31418.79	4.2532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748231:767973-769170(-)

Full Sequence      

MKFLSLATFITTALSGISGAEAYWKGFNVGANNPDGSCKSQADWKTTFNTLKGLPGYFTS
VRLYASSDCNTLENAVPAALATGMQILVGVWTEDDTHFNNEKQALLAAIQQYGSDWIIAV
SVGSEDLYRGDTNPAKLASQINDVRGMIRSVGANQEVGHVDTWTAWVNSTNNAVIMASDF
VGLDGYPYFQGAAIQDGANVFWQSVQATRDAVNSVKPGTWVWITETGWPVSGANDGSAVP
SISNAQAYWTNVACAAFEQANTFWYAYQDYSDSPSFGVVDANRKPIYNLAC

Enzyme Prediction     

No EC number prediction in K441DRAFT_699823-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	56	291	5.5e-23	0.9163987138263665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.63e-60	1	283	5	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.00e-24	26	291	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW94742.1|GH17	2.38e-146	21	290	17	286
UJO17243.1|GH17	2.82e-131	17	289	14	286
VDB89901.1|GH17	6.79e-126	4	291	1	293
USW52169.1|GH17	3.94e-124	22	291	19	289
CCD34315.1|GH17	1.60e-117	1	291	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.34e-30	19	285	33	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.13e-29	19	285	33	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	3.12e-70	20	291	16	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.45e-70	20	291	16	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	5.28e-69	4	291	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.99e-68	20	291	16	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	7.20e-68	4	291	1	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999715	CS pos: 19-20. Pr: 0.9865

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_699823-t45_1-p1.