CAZyme Information: K441DRAFT_691019-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_691019-t45_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	KV748256|CGC1	87138.45	8.0769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748256:431358-435235(+)

Full Sequence      

MXTFDIGGVLAQLTVAEKVELLSGTDFWHTKSIPRLSIPAIRITDGPNGARGTRFFNGVP
AACLPCGTAMGATWDIDLMRTAGELMGDEVKAKGGHVLLGPTVNIQRSPLGGRGFESFSE
DPTLSGSMASAIVQGVQSKGVAATVKHYVCNDQEHERMGVNAIVTERALREIYLKPFQIV
QREAMPKAYMTAYNKVNGIHASENRKLITDILRNEWEFDGVVMSDWFGVYSAAKAVNAGL
DLEMPGPPRLRGNHIMYALNSKKLSMHAINNCVSNVLQLVNHCCKLGVPEKASEGTINTP
ETASLVRRVASSSIVLLKNEGDILPFKKEKQIAVIGPNAKFAAYSGGGSANLRPYYAITP
YDAIKKQCKNVEYALGATAQKNLPELGKLLRTADRRPGYNMKGTLAPGEDGIWDFGLAVH
GTAQLFIDGELVVDNLTHQRSRNSFFGSRTVEERGSIDLKAGRRYNFLVRFGSAPTSNCK
MPSGVAPLPTPLQVDHCPLHGGGLNFGGSPRINPKAEIQKAVKLVKEVDQVVICAGLNSE
FESEGFDRPDMDLPGHINELIFAVVAANPNTAVVLQSGTPVTMPWIGEVKAVLQAWFGGN
ECGNAIADVLLGTKNPSGKLSLSIPIRCEDNPAFLTFRSERGRALYGEDVYVGYRFYEKV
KRDVLFPFGHGLSYTGFEMKNLRVQKNEEADKLSISVDVKNTGKMDGEQVVQVYISQVAP
SVQRPVKELRGFKKVMVPAGSSEGATLTVSLKYATSWWDEGRDMWIAEKDEYRVLVGDSS
ANAPLEATFELAKSSWWLGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	6.2e-72	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.60e-81	35	791	101	764	beta-glucosidase BglX.
224389	BglX	6.89e-79	6	366	30	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.67e-57	314	654	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.88e-44	13	749	60	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.65e-41	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY29662.1|GH3	0.0	4	800	8	836
SMR61167.1|GH3	0.0	4	800	8	836
SMR64317.1|GH3	0.0	4	800	8	836
UJO24157.1|GH3	0.0	4	800	6	834
SMQ55981.1|GH3	0.0	4	800	8	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.75e-249	1	800	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.05e-243	4	800	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.98e-158	5	786	4	663	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.92e-129	13	791	12	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	8.40e-108	9	788	57	825	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	2.99e-308	1	800	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.44e-307	1	800	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q0CAF5|BGLI_ASPTN	7.95e-306	1	800	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.51e-304	1	800	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.81e-301	1	800	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998610	0.001403

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_691019-t45_1-p1.