CAZyme Information: K441DRAFT_687923-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_687923-t45_1-p1
• CAZy Family: GT15
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		57660.33	7.1194

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748203:607717-609662(-)

Full Sequence      

MTTSITASNFYKRKFNYLIVGGGTAGLVVAARLSEDPNTTVGVLEAGPASFDDPLINVPG
RFGESLSTKYDWQFDTIPQAGLNGRKLSWPRGKVLGETSALNFMTWNRGNREDYDAWEEL
GSPGWRWDSVLSAFFKKTESFQEPSPVHQAQHRFHFTADFHDKSGPITSHTTLNNLGVET
NSSHFSGSNLGVWTTLTSVDPKLRTRCYLATAYCLPNSSRNNLVVLTEAVVNKVTVGASH
EVILSAGSVQSPQLLELSRVEVVTAMIYEIGPTIIGPDGLHADPKLAELADLTYSSSQSG
IRAMLPCSLSYVPVSHIMPLQDITDVLSKLSTTSGSKRDPVLVKQFSPDKKRGQIEYLFD
VGNWSPYFNSVPGKKYGTMLTMLQLPFTKGSIHIPPRSSLGPSRIEDKSIIDPQYYAGQG
GDVDFTIMVAAQKFANRICSTAPPSNIIKTRISSGLSETTDWHPVGTCSMSGSAGTEAGV
VDERPMVYGVKGLRVVDASSIPLHICSHPQATIYAIAEKTASMILEDRAK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	529	1.1e-69	0.5097087378640777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.36e-65	12	529	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.70e-57	13	525	4	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.45e-23	386	519	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.09e-19	83	258	15	200	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.31e-05	4	258	45	298	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87580.1|AA3_2	5.82e-180	10	527	7	607
QMW26329.1|AA3_2	5.82e-180	10	527	7	607
UCK58874.1|AA3_2	8.24e-180	10	527	7	607
QMW38412.1|AA3_2	1.51e-160	10	527	7	581
VBB84304.1|AA3_2	1.58e-158	1	527	1	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.63e-49	15	527	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	7.55e-44	15	528	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.74e-43	15	528	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.55e-39	15	527	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
1GPE_A	8.12e-39	13	530	23	585	Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense],1GPE_B Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	6.80e-64	4	527	3	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.80e-64	4	527	3	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	9.38e-60	6	527	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.65e-56	13	525	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.65e-56	13	525	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999544	0.000514

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_687923-t45_1-p1.