CAZyme Information: K441DRAFT_685079-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_685079-t45_1-p1
• CAZy Family: GH79
• CAZyme Description: glycosyltransferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		45453.30	5.8231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748183:1995792-1997209(+)

Full Sequence      

MTSRRTAPKYAYATLITCPSYLAGVILLAYTLRKHSPSYPLIILYTPSSLPTSCIAALES
ESRHSNLTLYPVEPLLPPNSDPKHLIAERFADTWTKLRVFELPSLPHTKICFLDADMLVL
RDPSAVFDSEPLPDDGILATHVCVCNLDHDRDPWAPASWTPPNCAYAGLTHPSALSHPRP
VTPDAPLEHRLLDSGMFVFAPGQRLGESLMRAFESAEPGSLAAYTFPGQDFMTAFFEGRW
RSVGYQFNALKTMRYWHPDMWDDGSVCCLHYIADKPWAARVGEDGVAGYKGNDGVTHRWW
WEEFGKWEKDREGEEELVGVVRQYVAGENGEEREDLRAIGSQTQPFAIHPQRHQEQTNSE
GNANDQVDEEPQQAPYRPVLRKKMLGEKGHGPVVRMHGRSMVDP

Enzyme Prediction     

No EC number prediction in K441DRAFT_685079-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	9	278	4.3e-27	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.20e-53	10	302	1	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	2.73e-15	8	278	21	267	galactinol synthase
279798	Glyco_transf_8	1.76e-05	21	277	10	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
132996	Glyco_transf_8	2.30e-05	10	128	1	117	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
227884	Gnt1	0.002	89	128	152	189	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYG85442.1|GT8	4.97e-133	9	395	5	394
QRD01038.1|GT8	2.65e-121	9	398	11	397
QIW98437.1|GT8	1.57e-119	1	347	1	347
QDS71582.1|GT8	6.51e-119	8	344	7	344
CBY00837.1|GT8	1.06e-115	6	394	11	409

PDB Hits     

K441DRAFT_685079-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O22693|GOLS4_ARATH	1.95e-16	3	300	16	289	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q9XGN4|GOLS1_AJURE	1.75e-14	21	300	35	288	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O22893|GOLS1_ARATH	2.59e-14	21	300	42	296	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|Q4PSY4|GOLS7_ARATH	4.24e-14	3	300	13	286	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|O80518|GOLS3_ARATH	7.82e-14	9	300	15	282	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000010

TMHMM  Annotations     

Start	End
12	31