CAZyme Information: K441DRAFT_683583-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_683583-t45_1-p1
• CAZy Family: GH76
• CAZyme Description: glycoside hydrolase family 132 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		44858.61	4.2781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748176:6348243-6349628(+)

Full Sequence      

MXLTEVLLIEVLLFVGAAFAAVQPHRHRHRHAPRDLINREPNPVADGAYPPVRTVILYML
NGSPISETEVMEGIHNGTLIWEDDGGLQEYHSSIPTPTPTPTPTPTSTPSPSVYVAEVSS
APASSAVESSVAPASSASYGEGVDKPFPSGLPCSSFPSGYGAVPVDYMGLAGWIGIQSPG
YSGGDGYNDISTVPKGSCPDGSCCKSGSFCSYNCPPGYLKASWPELQGLDGQSLGGLYCN
NGELEMASGSIAKTLCVKGTDKVEVVVQNKLSGCASICRTDYPGSEGETVPLQTEPDTIT
ELACPDGSDYYHWNNKPTSAQYYLNNLGVEQSDACWWGDGSQPVGNYAPANLGVGFIDGK
AWISLFQNAPTTTAKLDYTVEITGDNVVGKCKYSNGQYCSGDNYSDCNSVAGCTVAASSG
KITIVLS

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	117	426	2.8e-84	0.9504950495049505

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	5.07e-107	150	407	3	243	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQA29332.1|GH132	4.29e-119	56	427	50	433
UJO12597.1|GH132	4.29e-119	56	427	50	433
SMR44353.1|GH132	8.64e-111	12	427	7	425
SMR42173.1|GH132	8.64e-111	12	427	7	425
SMQ45830.1|GH132	8.64e-111	12	427	7	425

PDB Hits     

K441DRAFT_683583-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	5.84e-94	134	425	133	412	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	3.24e-80	140	427	171	447	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|Q59NP5|SUN41_CANAL	1.08e-59	151	426	166	416	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P40472|SIM1_YEAST	4.24e-59	151	426	224	474	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	6.26e-57	151	425	111	360	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000421	0.999555	CS pos: 20-21. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_683583-t45_1-p1.