CAZyme Information: K441DRAFT_675313-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_675313-t45_1-p1
• CAZy Family: GH63
• CAZyme Description: copper radical oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	KV748185|CGC1	75541.09	5.5664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748185:1331239-1333310(+)

Full Sequence      

MLRELYVASNYDGRLEVFGVAPNNTIWHTWQIAPGGDWHGSWNELYNDTDQLRELCVASN
HDGRLEVFGVAPDNTIWHTWQIAPGGDWHGSWNELYNDTDQLRELYVASNHDGRLEVFGV
APNNTIWHTWQIAPGGDWHGSWNELYNDTDQLRELCVASNHDGRLEVFGVAPDNTIWHTW
QIAAGQWLSAKSRIGHFDLQGATLAMAGVHAAMLHNGRVLYFSYDPNEENTLERAFWQLW
NPVDDAVTPVRVHSRNLFCAGHCFLGDGRLLVSGGQSYNWFPWIHPGADHDVHTFNPETN
TWARHEDMPGARWYPTCVTLPSGDGLMAGGHAVRYRPVGAINNEYENFQWQTDQKTQPRA
FNPGHIDAYPFLCVLPDGTSAGTLFAFSRREARLFSLENQTWTGRFPTASQDWRTYNRQG
AFVLLPLLPGESEQTRIMVFGGGGPGSKATSTAEIFEFNQADPSASVWRRPAGGDMAFQR
FMSDAVLLPDGTVLVVNGAAEGVADDSKQPVMAAELFNPRDESWHTLALLNRPRQYHSAA
LLLPDARVVISGHTEHWNPGHKFEETTLDVYSPPYLFKGRRPTIDSAPSKMSYGTQYNIT
TTGDVASVALLRAGSTTHTNNMDQRHVGLLLRREDDQLVVTAPPSGTVAPPGYYMLFVVG
PGGVPSIAKWVLIAGDAL

Enzyme Prediction     

No EC number prediction in K441DRAFT_675313-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	151	676	1.9e-121	0.37236533957845436

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199882	E_set_GO_C	4.11e-39	576	673	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
401164	DUF1929	9.69e-29	587	673	2	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
399910	Glyoxal_oxid_N	7.78e-10	210	442	2	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
276965	Kelch	7.17e-06	436	542	12	103	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
276965	Kelch	3.25e-04	267	331	10	66	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS80362.1|AA5	7.25e-93	204	673	10	510
BAY23246.1|AA5|CBM42	1.23e-54	208	676	48	505
UKO99090.1|AA5|CBM42	2.08e-52	208	676	39	496
BCJ42775.1|AA5|CBM13	1.19e-49	209	674	140	594
AGL16794.1|AA5|CBM13	2.22e-49	201	674	101	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RYW_A	2.35e-36	255	671	270	687	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
6RYV_A	2.35e-36	255	671	270	687	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001],6STX_C Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
6RYX_A	4.22e-36	255	671	270	687	Copper oxidase from Colletotrichum graminicola [Colletotrichum graminicola M1.001]
1T2X_A	9.96e-28	240	671	207	635	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
6XLT_A	1.83e-27	216	671	181	636	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	3.38e-35	195	671	15	519	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	2.14e-32	222	676	460	906	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	4.52e-30	254	673	174	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|P0CS93|GAOA_GIBZA	1.41e-26	240	671	248	676	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|I1S2N3|GAOA_GIBZE	1.87e-26	240	671	248	676	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000010

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_675313-t45_1-p1.