CAZyme Information: K441DRAFT_673957-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_673957-t45_1-p1
• CAZy Family: GT8
• CAZyme Description: glycosyltransferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	KV748180|CGC3	45397.96	4.8894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748180:1714796-1716146(+)

Full Sequence      

MLLTGGQVSMAISSTIVFTFTSLLFLSGYVLQQKTLHSLQAAIKPRLPKPLTAPTPSIAP
LNLNVKWARPVGGRPSSDADFDQYISEQTIDWSRLGYVQLVKEHVEVCSAMMLFGDLYRL
RSPAKRVLLFPRAWLEGATGEVVDPYLRTSRRLLRMAARRYGVVLMPMEPIIEGADNSLP
SSYSLASLFSLVDYERIIHLSSPGLLLDASPLDSLLAFSESEPVAALPANAERKELLTSL
LLIHPSAENYSRLRELRSTQPMTDLDLFRKSFPVPDSLLSSWSMSLGNLFYESTSLRNSI
EGFNSTIFTEATAYVRLSDPELPGPEYDVPYYDRVRIRPKNEEARFVWEKLYETFRQRRM
EICGLDLETWSSPVLQAETMADESGTVAEESQVADEIVKQAQDL

Enzyme Prediction     

No EC number prediction in K441DRAFT_673957-t45_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	5.65e-14	97	255	3	148	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7187439.1|GT0	1.57e-172	1	390	4	390
CBX97186.1|GT0	3.90e-172	1	388	4	387
QRD04268.1|GT0	1.73e-161	1	368	4	369
QDS75010.1|GT0	1.48e-102	1	404	1	403
UJO17613.1|GT0	7.31e-90	1	370	5	382

PDB Hits     

K441DRAFT_673957-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.10e-13	90	363	150	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000007

TMHMM  Annotations     

Start	End
9	31