CAZyme Information: K441DRAFT_671166-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_671166-t45_1-p1
• CAZy Family: GH51
• CAZyme Description: FAD-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		61777.75	5.8513

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748266:263532-265209(+)

Full Sequence      

MEQAIQAFRSQQISVLVPGQDKYRQAIATSNLLFRFSRPECVVQPENPAQVQTIIKEAAA
RSIKVTIKCNGHSYAGHSTAFSGISLDLRSMKNAELDMNSKMVTMDAGCQWGDVYDKLII
GHHDGYIINGGRCPTVGVSGFILGAGLGPFTRSFGMGADTLAEATLVTADGSLITVRESD
PPTSEKGRLFWALRGAGGGNFGVVVQMKLHVQKLRNLQGMVVAGRYQWFPQSGFTDDVVA
TMNTFYRTPWPQELTIDTTWICDLRQSSNQGGVRFNVSFDGNKVEYDRLITTHITHPELQ
TQLKRRVLAEKSSRFLYETLVAQWLEEAERAYPSNKTYELYSSFIFTKSSDFAKITAAIC
ERMAFFRQKFNGEQVNFLVTWIHSGGKASEPQPTDTAFFWREAVFHAYVTVEWVDKWMEL
EMRLFLASVKKELRPLSLNEKAAFMNFPDRDFPTKLHEERYFGGNKEELRKVKQTWDPNG
FFKWVHGVRRPGDPEEDDTAEEYAERTDKFAREQWADQWTYYKADDLEVDLNDLEECLGV
ESD

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	37	483	1.9e-63	0.9606986899563319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.29e-30	39	177	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	5.51e-25	38	482	31	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.06e-11	443	489	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	3.23e-04	35	94	61	122	cytokinin dehydrogenase
273751	FAD_lactone_ox	4.47e-04	39	218	15	185	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7214923.1|AA7	1.33e-24	9	482	34	483
QRW27390.1|AA7	8.00e-24	14	488	42	490
UPK90596.1|AA7	1.32e-23	39	495	20	447
EGX49222.1|AA7|CBM1	6.02e-23	10	482	136	586
AHG26149.1|AA7	6.83e-21	14	489	17	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO5_A	1.09e-24	18	488	28	468	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	1.46e-24	18	488	28	468	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
2IPI_A	1.54e-22	15	492	31	521	Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_B Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_C Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus],2IPI_D Crystal Structure of Aclacinomycin Oxidoreductase [Streptomyces galilaeus]
2Y08_A	5.16e-21	13	491	34	528	Structure of the substrate-free FAD-dependent tirandamycin oxidase TamL [Streptomyces sp. 307-9],2Y08_B Structure of the substrate-free FAD-dependent tirandamycin oxidase TamL [Streptomyces sp. 307-9],2Y3R_A Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_B Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_C Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3R_D Structure of the tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P21 space group [Streptomyces sp. 307-9],2Y3S_A Structure of the tirandamycine-bound FAD-dependent tirandamycin oxidase TamL in C2 space group [Streptomyces sp. 307-9],2Y3S_B Structure of the tirandamycine-bound FAD-dependent tirandamycin oxidase TamL in C2 space group [Streptomyces sp. 307-9],2Y4G_A Structure of the Tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P212121 space group [Streptomyces sp. 307-9],2Y4G_B Structure of the Tirandamycin-bound FAD-dependent tirandamycin oxidase TamL in P212121 space group [Streptomyces sp. 307-9]
3VTE_A	6.52e-21	38	483	53	505	Crystal structure of tetrahydrocannabinolic acid synthase from Cannabis sativa [Cannabis sativa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q796Y5|YGAK_BACSU	6.63e-26	23	488	18	442	Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaK PE=3 SV=4
sp|O06997|YVDP_BACSU	2.11e-25	15	488	10	443	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q9SVG7|BBE17_ARATH	3.10e-25	42	488	79	522	Berberine bridge enzyme-like 17 OS=Arabidopsis thaliana OX=3702 GN=At4g20800 PE=2 SV=1
sp|Q9FZC6|FOX3_ARATH	1.07e-22	42	483	80	516	Berberine bridge enzyme-like 5 OS=Arabidopsis thaliana OX=3702 GN=FOX3 PE=3 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	2.29e-22	43	488	123	547	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_671166-t45_1-p1.