CAZyme Information: K441DRAFT_671-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_671-t45_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865		97248.31	5.7095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748176:291297-294323(-)

Full Sequence      

MVKFLHRRCTQAKWLEPPEDEFGIVDGGAADLGVMLRRSDGIYTAEPMFLNQDLVAAVEK
LGVAVAFTMSSEITLALLQQVTPFQTEFSLDPRGFMLPIVNSLKDIATGKSAITKDAYVC
LCRQERLVLVWGDTVPGILAHGTDIETRLLGLVWGSHISNPGTASPYRQSVSPGQIRQSM
FPIASHRGSGPMPAEMNEKIDAIDRAIEVEEQGDKAFDPEKEGEELPERPFLLIHAMLVG
LAMVLVVVVEMACLAKLITEYRLDGKMLRFALVATIPLFASFSLFFMIVITGSLFQLFGP
LSSVQGNSVYYSGKAPKPQRHPNIELPHVTIQMPVYKEGLKGVIIPTVTSLLDAVKHYEE
QGGTASIYVNDDGMRLVKEDMQEARKAFYELNHIGWCSRPAANPDKDSPDYYVRKGHFKK
ASNMNYCLDFSIRVEDELLKLIADTCRERSCTQDDLSIEDEDKLYEQARNTIVERDDGKT
WAAGNVRLGEVILIIDSDTRVPEDCLLYGALEMHESPEIALLQHASGILQVVNNVFENGI
TYFTNLIYTSIQFAVGNGDCAPFVGHNTFIRWKAIQSIAFEEDGQTKFWSEDHVSEDFDV
SLRLQMNNFVVRLATYHNGGFKEGVSLTVYDELARWEKYAYGCNELVFHPLHKWVYKGPL
TPLFRKFLFSNIKITSKVTILAYIGTYYAIASAIPLTLANYLIVGWFSDNVDQFYITSWK
IFVGMAVIFNVLSPTAYAMLRHRLGQTTFFWSLVETAKWTPMFLLFFGGISYHLLKAILC
HFFSIKMEWTTTAKELTESGFRVGLDRIVRDFKYMYLFILPAIGGMIYLAQYAPRGWAIS
DFAAIVPLANQIGCHALLPFALGLF

Enzyme Prediction     

No EC number prediction in K441DRAFT_671-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	491	719	8.2e-52	0.9289340101522843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	8.01e-49	491	704	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.28e-09	441	796	89	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.36e-09	451	597	35	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW95398.1|GT0	0.0	1	865	49	921
ATZ55570.1|GT0	0.0	1	865	67	938
APA12832.1|GT0	0.0	1	865	67	938
QSZ28760.1|GT0	0.0	1	840	67	913
QKX64636.1|GT0	1.12e-304	1	859	30	882

PDB Hits     

K441DRAFT_671-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

K441DRAFT_671-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000000

TMHMM  Annotations     

Start	End
236	258
270	292
683	705
718	740
763	785
814	832
842	864