CAZyme Information: K441DRAFT_669149-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_669149-t45_1-p1
• CAZy Family: GH5
• CAZyme Description: carbohydrate esterase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218		23009.27	6.8456

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748243:161898-162700(-)

Full Sequence      

MYSRTLFRLALPTFLLSLYHPLATSLLHITARTPIAPGTELRILPLGDSITYGWNSTAGT
DGYRLKLSTDLSGSDLLFIGTQRSGSMSDNHNEGHPGFTISRIAAVAGPALAMRPNIILL
HAGTNDLHNRPPPANESYADAPARLGALVDELVERCPGAVVLVAQIISVASASAEARIRA
FNEAVPGVVRERVERGGKVAVVDMSGVGVGELVDGSHP

Enzyme Prediction     

No EC number prediction in K441DRAFT_669149-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	41	218	5.9e-43	0.9123711340206185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	9.55e-45	41	218	1	141	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.25e-16	46	207	2	150	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	6.87e-14	43	218	1	172	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238870	SGNH_hydrolase_like_1	2.01e-06	42	207	1	154	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
395531	Lipase_GDSL	1.49e-05	43	166	1	135	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7021644.1|CE3	7.00e-51	39	218	40	221
UJO20274.1|CE0	1.16e-46	28	218	35	226
VDB86298.1|CE3	5.63e-40	40	218	72	248
UPK97767.1|CE0	8.26e-39	34	218	48	236
UKZ47743.1|CE0	4.35e-38	33	218	55	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	6.48e-10	41	205	6	162	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

K441DRAFT_669149-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.027340	0.972621	CS pos: 25-26. Pr: 0.8674

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_669149-t45_1-p1.