CAZyme Information: K441DRAFT_669102-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_669102-t45_1-p1
• CAZy Family: GH5
• CAZyme Description: glycoside hydrolase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1104		126672.11	6.2984

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748242:788294-792186(+)

Full Sequence      

MGRIDETPINDPKNKDWYLFRPADDFFDSLQGAVRPTSVTYEDDDQKKSDGQDNPACSHG
RVFRFNDNLGFVLIQFMRPHIWRIRFHHVNQSGAGFSDYNTRTIVQDTLSDMIRILDVAE
HVNWQVELQTEDARYFILQSVIDPGLSTQRVGVQLWIQRNPFRITAVRSVRAASASAILP
QLQAPIDASVASKLRIEEAQGMNNAIIWQTKVRPLQYIQDAAILSVEKPSIARYAGFGEQ
GGKRMFKDNVFMNYFNFDNMRYYNVYGEGPLKDDEPLYHSEPYWIEMNAHPGHLSQVGYF
VDNYSQVCVDLGKTDPTTIRIATRFNSFQCIIMAGDDIGDIIRSYTSIIGRPNLKPRFIL
GNHQGCYGYDEQWKVTQAVDKYRQYGIPLDGMHVDVDIQRDYRTFTIDTRTFPDPRGMFS
DLRKKGVKCSTNITPVINMRPDSTYTTLNEGLQHGYFVKDVRELDPGAPSPSQQRCLDFG
NGHRYFKDPNKKNNFNIDSEKDNRPPFSPPDDYDFDNVFNSGQPFHGAVHYGGDRGAPGH
YPNLNSQKVRDWWGKQYQYLFDTGLEFVWQDMTSPCMAKEYGDMRSFPFRLLLDSDGWSG
DPHADAQKKAIEIWSLYSYNLHKATFQGLSVLPGREGKRNFIIGRGSFAGAQRYAGLWTG
DNVSSWEFFDISVAQVLSLGLAGVLISGADVGGFEPLDGIEENLCADPELLIRWYCAYSL
LPWFRNHYTAKPGKKSFQEPYAYIEWFNNNSQRIPSTDYRMWWAVLPVCRYVIQLRYSLL
QLMYDAMFENLWTGLPIARAMIVTDPMDTSLYQTNQWYTRSQYLVRNDLLVAPALYKERV
RDRRKLYLPYPDSWYPMNLRPRWNDNASLGMPLGALTRGGSYINYDCRISPDESQLPYVN
PMXIREGAIIPQIEVRQSVPDRSRFPNEPAIPVTINVYPGKDRVNSLYKDESYNMYLDDG
VSRESAPDNVYLSALTDDTKSSDKKLLTDYYGDKQAASKFRHVRVEQTTTRSIISSQLHE
IRTVTITSPHSDYSDDLVKRDIGAEYKIVFWHDPDTNVNLNDVKADITSIGNSRSAQDWN
ARATVAWIPTSKVDKAVIEVSYPV

Enzyme Prediction     

EC	4.2.2.13:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	332	910	3.1e-107	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269887	GH31_lyase_GLase	6.60e-153	350	794	1	347	alpha-1,4-glucan lyase. GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end. GLases cleave the bond between C1 and O1 of the nonreducing sugar residue of alpha-glucans to generate a monosaccharide product with a double bond between C1 and C2. This family corresponds to subgroup 2 in the Ernst et al classification of GH31 enzymes.
395838	Glyco_hydro_31	2.11e-101	332	910	2	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269890	GH31_glucosidase_II_MalA	6.04e-76	350	794	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
224418	YicI	6.32e-73	203	962	118	709	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269889	GH31_GANC_GANAB_alpha	1.82e-66	350	962	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA10229.1|GH31	0.0	13	1103	22	1108
UPK99728.1|GH31	0.0	1	1091	1	1064
UQC75753.1|GH31	0.0	9	1093	6	1095
QPC65578.1|GH31	0.0	1	1092	1	1064
CEI38459.1|GH31	0.0	1	1102	1	1095

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X2H_A	3.06e-48	247	969	217	923	Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase [Gracilariopsis lemaneiformis],2X2H_B Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase [Gracilariopsis lemaneiformis],2X2H_C Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase [Gracilariopsis lemaneiformis],2X2H_D Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase [Gracilariopsis lemaneiformis],2X2I_A Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase with acarbose [Gracilariopsis lemaneiformis],2X2I_B Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase with acarbose [Gracilariopsis lemaneiformis],2X2I_C Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase with acarbose [Gracilariopsis lemaneiformis],2X2I_D Crystal structure of the Gracilariopsis lemaneiformis alpha-1,4- glucan lyase with acarbose [Gracilariopsis lemaneiformis],2X2J_A Crystal structure of the Gracilariopsis lemaneiformis alpha- 1,4-glucan lyase with deoxynojirimycin [Gracilariopsis lemaneiformis],2X2J_B Crystal structure of the Gracilariopsis lemaneiformis alpha- 1,4-glucan lyase with deoxynojirimycin [Gracilariopsis lemaneiformis],2X2J_C Crystal structure of the Gracilariopsis lemaneiformis alpha- 1,4-glucan lyase with deoxynojirimycin [Gracilariopsis lemaneiformis],2X2J_D Crystal structure of the Gracilariopsis lemaneiformis alpha- 1,4-glucan lyase with deoxynojirimycin [Gracilariopsis lemaneiformis],4AMW_A CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-idosyl- fluoride [Gracilariopsis lemaneiformis],4AMW_B CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-idosyl- fluoride [Gracilariopsis lemaneiformis],4AMW_C CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-idosyl- fluoride [Gracilariopsis lemaneiformis],4AMW_D CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-idosyl- fluoride [Gracilariopsis lemaneiformis],4AMX_A CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-glucosyl- fluoride [Gracilariopsis lemaneiformis],4AMX_B CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-glucosyl- fluoride [Gracilariopsis lemaneiformis],4AMX_C CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-glucosyl- fluoride [Gracilariopsis lemaneiformis],4AMX_D CRYSTAL STRUCTURE OF THE GRACILARIOPSIS LEMANEIFORMIS ALPHA-1,4- GLUCAN LYASE Covalent Intermediate Complex with 5-fluoro-glucosyl- fluoride [Gracilariopsis lemaneiformis]
5F0E_A	2.42e-41	271	883	221	723	Murine endoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
5IEF_A	2.88e-40	284	883	290	778	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	2.89e-40	284	883	290	778	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5IED_A	3.09e-40	284	883	312	800	Murine endoplasmic reticulum alpha-glucosidase II with castanospermine [Mus musculus],5IEE_A Murine endoplasmic reticulum alpha-glucosidase II with 1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9F234|AGL2_BACTQ	1.87e-61	234	960	149	719	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|P79403|GANAB_PIG	2.99e-44	284	883	322	810	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q9FN05|PSL5_ARATH	4.52e-43	277	964	270	822	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|B9F676|GLU2A_ORYSJ	5.93e-43	255	912	258	779	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q14697|GANAB_HUMAN	1.15e-42	284	883	322	810	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000000

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_669102-t45_1-p1.