CAZyme Information: K441DRAFT_659354-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_659354-t45_1-p1
• CAZy Family: GH27
• CAZyme Description: D-arabinono-1,4-lactone oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		66566.57	6.5496

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748194:1105838-1107610(-)

Full Sequence      

MNLTPLPPTNMASRFSIELEKLDPTVPFRASQTHTHHTWARTFHSRPELYIRPQTLAEVQ
KVVTLARRLRRRVVVVGSGHSPSDLTCTSAWMVNLDDFNSVLTVDAEKKTLLVQAGIRLH
QLNNKAKEYGLTMRNLGSIDHQSIAGAIATATHGSSLSHGLLSQSVKSLRIVLANGQAVK
CSKEQNEELFRAALVSLGALGIIVEVEFEMIENCNIEWFQTILAASTVLRNWERTLWTQT
EYTRVWWLPYTLRAVVWRAEKTTKPFCQPKHNWYGGSIGYHTYHTLLWAAQYVPRLLPSI
EWFVFGMQYGFHDGFTTSAVEELRSGLLMNCLYSQFVNEWALPLHKGPEALTRLTAWING
DTDTARIPFDPLGVFVHSPIEVRVSDTSAADPRPFLDNTVRDGPTLYLNATLYRPYGQDP
PCLRRYYQAFEWLMREMGGRPHWAKNFTDGVTHGVLSALYGEDMAAYLRVRAEVDPEGMF
VGDWHRRTVLPPRAELPVLALEEKEVVRRPKRGGGVEWVGEQARWWDGGAGMGSGRSESE
ESFDLMVGAEAEASVLLESLREDMEEDEVDALQGRKHGNATGVYGDEGVR

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	38	238	5.1e-26	0.44759825327510916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273751	FAD_lactone_ox	1.05e-133	39	483	7	438	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
397924	ALO	4.33e-90	206	487	1	258	D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.
223354	GlcD	8.30e-35	40	480	25	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215258	PLN02465	1.51e-34	33	484	83	565	L-galactono-1,4-lactone dehydrogenase
130737	GLDHase	1.13e-33	34	271	49	285	galactonolactone dehydrogenase. This model represents L-Galactono-gamma-lactone dehydrogenase (EC 1.3.2.3). This enzyme catalyzes the final step in ascorbic acid biosynthesis in higher plants. This protein is homologous to ascorbic acid biosynthesis enzymes of other species: L-gulono-gamma-lactone oxidase in rat and L-galactono-gamma-lactone oxidase in yeast. All three covalently bind the cofactor FAD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX64016.1|AA7	8.96e-07	26	223	19	224
UQC82080.1|AA7	6.34e-06	46	209	48	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7A24_z	2.18e-28	34	275	110	342	Assembly intermediate of the plant mitochondrial complex I [Brassica oleracea]
2VFR_A	1.06e-19	39	486	13	417	Alditol Oxidase from Streptomyces coelicolor A3(2): Native Enzyme [Streptomyces coelicolor A3(2)],2VFS_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Xylitol [Streptomyces coelicolor A3(2)],2VFT_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sorbitol [Streptomyces coelicolor A3(2)],2VFU_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Mannitol [Streptomyces coelicolor A3(2)],2VFV_A Alditol Oxidase from Streptomyces coelicolor A3(2): Complex with Sulphite [Streptomyces coelicolor A3(2)]
6HFV_A	5.78e-09	23	210	13	205	Mycobacterium tuberculosis DprE1 in complex with CMP2 [Mycobacterium tuberculosis H37Rv],6HFV_B Mycobacterium tuberculosis DprE1 in complex with CMP2 [Mycobacterium tuberculosis H37Rv],6HFW_A Mycobacterium tuberculosis DprE1 in complex with CMP1 [Mycobacterium tuberculosis H37Rv],6HFW_B Mycobacterium tuberculosis DprE1 in complex with CMP1 [Mycobacterium tuberculosis H37Rv]
4KW5_A	6.95e-08	39	210	16	191	M. tuberculosis DprE1 in complex with inhibitor TCA1 [Mycobacterium tuberculosis H37Rv],4KW5_B M. tuberculosis DprE1 in complex with inhibitor TCA1 [Mycobacterium tuberculosis H37Rv]
5OEP_A	7.15e-08	39	210	32	207	Mycobacterium tuberculosis DprE1 in complex with inhibitor TCA481 [Mycobacterium tuberculosis H37Rv],5OEP_B Mycobacterium tuberculosis DprE1 in complex with inhibitor TCA481 [Mycobacterium tuberculosis H37Rv],5OEQ_A Mycobacterium tuberculosis DprE1 in complex with inhibitor TCA020 [Mycobacterium tuberculosis H37Rv],5OEQ_B Mycobacterium tuberculosis DprE1 in complex with inhibitor TCA020 [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SGY1|ALO_NEUCR	1.34e-180	8	522	13	550	Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alo-1 PE=3 SV=1
sp|Q6CG88|ALO_YARLI	1.64e-123	30	481	9	514	D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALO1 PE=3 SV=1
sp|O93852|ALO1_CANAL	1.26e-108	36	481	18	543	D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALO1 PE=1 SV=1
sp|Q6CSY3|ALO_KLULA	2.06e-104	39	483	19	513	D-arabinono-1,4-lactone oxidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALO1 PE=3 SV=1
sp|Q6BZA0|ALO_DEBHA	1.43e-103	36	484	19	547	D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_659354-t45_1-p1.