CAZyme Information: K441DRAFT_659046-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_659046-t45_1-p1
• CAZy Family: GH25
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
958		108800.87	7.4552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748193:1167218-1170513(-)

Full Sequence      

MQPVIPVMVENVAQYSPFLLPAAFLVVSIISTINTPVQHSLLITSISWGLIWIFSIARAG
LYSGFDNTIRKKFSWAAGGLFALAQICERAARDREGIWWTKALLPGLIFLLLETEFWPRA
GALPNFFPLDGHSIESGSSAEGGTHTGSSRLLIIVTLSAGAVLSTPFITSPTSALGFSSA
FFTAAKLVLFENAIRHTKDEKNAESRGLVSANGTFSRRNSLDGAQQEHYITSLRDVAAVI
TISCGAAAFFMEGFRADVLTWNPEIAKLEGDWKLVQNHRMIKQCVLMILVGTLEKILLFM
TLYQQGALRTSFVVVAAYLYARLNIASSLSGAWFTAIFASTSILFLYNPSSSTQSIFGRR
STMRAKRIVLLLGLLSFTILFVQFFYHTVTLRSFDRSNTPIIEVNPSIEPFGPLQLDTKK
GHPVDQLIRSSEQEFKNQLARQSVSLADAVSEYRRRYRIPPPPRFEKWYEFAMRADIQLI
DEFDTINEALLPFWALKPSTIRARVREVLGSDENSLIGLSIRDGEAVKIEGGAEWQQKAT
LGMIKNFVQHLPDMDVAFNIHDEPRVVVPHDQLSHIVEIARGQRMPAALANTSPLNAFSN
RPDDMGNGQRFPESKTTRFNHFAHQQTWTHARMSCSPNSPARSYEDVTADNLTSYAIGDL
GFVYNQSAFSDICMSPSFRQTYGFFERPNAFNVVHDLIPIFSQSKLSSFQDIIYPSPWYW
FGKVGYDEERDTDWDNKTNNLYWRGSTTGGFSRNGGWRRQHRQRVVQKMNAPDKAKILVN
QGQKKSPDWQMKEVPRQEYKDLFDVKFSHVGQCDPGDCDAQNEFFNVVDRADGQDAWQYQ
HLLDMDGNAFSGRFYAFLKSMSLVYKMSIFQEWHKDWLKPWVHYIPISLRGEEWLELIRY
FSSEEEGKLQAPNVAVQGREWANKVFRNVDFEVWFFRLLLEYGRIIDDNRETIGYPGP

Enzyme Prediction     

No EC number prediction in K441DRAFT_659046-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	676	946	4.1e-78	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.73e-16	695	944	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.03e-06	698	944	107	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7014360.1|GT90	0.0	1	958	1	977
CBY00666.1|GT90	0.0	1	958	102	1067
QDS74092.1|GT90	0.0	10	958	10	950
QRD06440.1|GT90	6.41e-310	1	958	43	1009
UJO10778.1|GT90	1.25e-291	10	957	12	958

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.54e-06	699	958	154	394	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	9.03e-06	698	949	117	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.45e-45	422	952	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.10e-08	834	946	277	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	4.87e-08	834	946	276	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	3.21e-06	698	946	162	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000001

TMHMM  Annotations     

Start	End
13	35
40	62
283	305
325	347
368	390