CAZyme Information: K441DRAFT_658348-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_658348-t45_1-p1
• CAZy Family: GH20
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661	KV748191|CGC2	71387.41	8.3227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748191:1390745-1393034(-)

Full Sequence      

MVFATKSIVALGFIATLLQNAVAQNGAYAQCGGIGFTGTSNDCVSGYYCNVQNDYYWQCV
TGTATARAAVASRVKTSTTLTKSVKTRSSPSTTIKKSATSLSIISSSSAASAPSGNACTG
TFTPISASAFVAALNPGWNLGNTLDATQTEGDWSNPPVVAATFDDVKAAGFKSVRLPVTW
AYHFHGSSPDWTIDPVWLQRVSDVIDMVTSRGFYTIVNAHHDSWIWADVSASGANYTMIE
EKFYRLWYQVGTKLACKSSLVAFEPINEPPGTTAAHAAELNKLNNLFLKAINDAGGFNSQ
RVVTLVGLGEDGVKTSKWFTPPNPTFTNPWAIQYHYYSPDRFIFGRGNTIWGSDADKASL
EADIAAVRGNFTNVPLLIGEWSASPVVTERAARWKYFDYFLQMARKYNTVPMLWDNGADY
LDRAAHTWRDQVAINILMNATASVANSLPDCTENGMATSQWTSAYIFHRVGTAVTDQTLP
FLLNGNTLKSISSPSKTLTAKTDYIVSGRNITFKASLLSAFVSSTTTPGSIANLTLTFSA
GAHLLVNIVQWDVPVLGSTTSAAVSGSDLSIPITWKGIGKPAAVRALKSDGTYLEDAWTV
YLEPLQRGRTSYGRQWKWDSSHVIITSAAIGDVISSGKTTTFMIEAYPRVPGNNVNYTLT
V

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4	3.2.1.4:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	150	417	4.5e-63	0.9891304347826086
CBM46	464	546	7.8e-18	0.9310344827586207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.90e-29	150	419	16	271	Cellulase (glycosyl hydrolase family 5).
397483	CBM_X2	7.47e-20	462	548	3	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
225344	BglC	4.34e-15	136	418	53	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
197593	fCBD	5.08e-11	26	60	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	6.17e-10	27	56	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFG25592.1|CBM1|GH5_4|3.2.1.4	2.73e-256	14	661	9	655
AIO06743.1|CBM1|GH5_4	2.73e-256	14	661	9	655
CAE7206214.1|GH5_4	2.83e-248	122	661	34	575
QQK43655.1|GH5_4	3.01e-242	112	661	38	592
QRC91267.1|GH5_4	3.32e-241	119	661	35	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	7.60e-96	134	602	31	488	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	4.91e-51	130	660	13	527	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	1.12e-50	130	660	46	560	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
4V2X_A	1.24e-49	130	659	61	574	Chain A, Endo-beta-1,4-glucanase (cellulase B) [Halalkalibacterium halodurans]
5E09_A	5.83e-49	130	660	13	527	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	2.71e-53	116	603	26	509	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|P28621|GUNB_CLOC7	7.07e-39	131	417	46	341	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
sp|P28623|GUND_CLOC7	1.51e-37	125	424	41	346	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
sp|P10477|CELE_ACET2	3.63e-36	125	417	55	352	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
sp|O08342|GUNA_PAEBA	2.05e-35	125	438	38	396	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999725	CS pos: 23-24. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_658348-t45_1-p1.