CAZyme Information: K441DRAFT_657914-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_657914-t45_1-p1
• CAZy Family: GH2
• CAZyme Description: glycoside hydrolase family 47 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		56588.82	4.3059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748190:1148048-1149746(-)

Full Sequence      

MGWLQFIFLGAFLPLTFGIPTYQRKVSSRAYGNGTESQYRANAVKEAFQFSWNGYKTYAF
PHDELHPVSNTYSDSRNGWGASAVDALSTALVMELPDIVNEIIDYIPTIDFSVTSEQVSL
FETTIRYLGGMLAGYDLLKGPLSSLAANDSNVDALLTQAKNLADILAYAFDTPSGIPHNG
LYIENKTTDNSPNNGLATTGTLVLEWTHLSDLTGDTTYADLSQKAESYLLNPRPASSEPF
PGLVGTNINITTGLFEDASGGWVGGDDSFYEYLIKMFVYDASRFREYRDRWIAAADSTIA
NLTSHPTTRPDLTFVAMFNNTLLVLVSEHLACFDGGNFLLGGEVLGRQDYIDYGLALVNG
CHDTYNSTATGIGPEAFSWDPNSVPANQSTFFQANGFYITNSIYDLRPEVLESYYYAYRI
TGDTKYQDWAWDAFVAVNATTRANSGFSEIENVNAPGGGAKGDFQESFWFAEVMKYAYII
HAPDAEWQVNSGGKNKWVFNTEAHPLKVRGPPI

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	47	508	9.1e-131	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	47	508	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.72e-118	31	512	63	522	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDO01992.1|GH47	2.45e-254	9	513	11	526
APA06883.1|GH47	2.45e-254	9	513	11	526
ATZ45864.1|GH47	7.80e-240	20	513	27	530
CCD45524.1|GH47	7.80e-240	20	513	27	530
VDB95110.1|GH47	5.73e-238	33	513	32	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.48e-222	37	508	2	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	5.38e-222	37	508	37	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	2.38e-174	34	509	9	493	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	7.77e-61	26	508	9	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	9.57e-61	26	508	7	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	2.21e-229	37	509	36	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	2.65e-229	31	508	33	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A2QAS2|MNS1B_ASPNC	6.17e-228	33	508	35	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|A1CP08|MNS1B_ASPCL	2.39e-222	40	508	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	2.77e-221	37	508	37	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999745	CS pos: 18-19. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_657914-t45_1-p1.