CAZyme Information: K441DRAFT_657574-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_657574-t45_1-p1
• CAZy Family: GH2
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931		101077.82	6.7736

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748189:1362619-1365636(-)

Full Sequence      

MVSKLKLDPVWDDLDRTMGQLFMMGFDGTTVTPQIRTLIEKHHLGCILLTAKNLKSAEET
TKLCYELQKVAHDAGHPVPLAIGVDQENGGVNSLFDEIYIRQYPSNMGIAATGSTDLAFE
VAKATAQEISACGINWIFGPCLDVLTNARNQPLGVRTAGDDPQEVSAYGVAFMKGYKEAG
LATLGKHFPSYGNLEFLGSTLDVPIITESLEQLSLSALIPFRNAIRQGLDSMMVGGCAMS
SAGLNAMHACLSEQVVDGLLRSELKFDGVVVSECLEMEALSHNIGVGGGTVMAVNAGCDV
VLLCRSFSVQQEAIKGLKTGIENSMISKDRIYNSLRRVLTMKSKCTSWEKALNPPGVNFL
ETLQPSHTALSTKAYNTSITVVRDKNRLLPLTNVIDGEEELLLLTPLVKPLAASAASRAL
SETVATASPEPAAWERSASVMSGERVFRELGRSLARQRSGRVLHTSYTANGVRPVHENLI
NRASAIIVLTADANRNLYQHGFTKHVSMICNMQYTTGGEKREKPLIVVAVSSPYDFAMDT
SIGTYICTYDFTETALNSLVKVLYGELSPSGTLPGTISKSQKLHHSRQHWLVETFNEERD
ANALDSLIVAVMEGTPPNQRSELSSATSNSFILHHPEVVEAHFVVRNSSTQALYGFCSTY
FFKTTGTGVIGALFVDPARRKLSIGHSLHNRAIRTLLQRDGIKRFQLGSRLPSIFLGIPT
GHGAERKRLRSWFANLGWNAALSRPICSMVARNLLTWIPPEGMAKSLAGAGAEFDLVYGW
EYAGPILDHIKTSNRQGLAEVYKLALADPSACGIIRAKRPEDGALVGTVVLYNMHSRLAE
YVPPMKDLNEMAGGISSPVISPAVGEYSTLLQGLILLGMRQIKAQGCNACILDYMDGDGS
FDGFSAMGFDVLHNFEEVSCDAATWTMIPPS

Enzyme Prediction     

No EC number prediction in K441DRAFT_657574-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	302	2.8e-52	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.74e-69	19	392	8	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.97e-61	14	341	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.68e-33	18	304	1	280	beta-hexosaminidase; Provisional
178629	PLN03080	6.67e-08	103	391	114	415	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92437.1|GH3	0.0	1	931	1	933
CAE7213699.1|GH3	0.0	6	931	6	934
CBX99837.1|GH3	0.0	1	931	1	886
UJO20030.1|GH3	0.0	1	931	2	932
SMY21386.1|GH3	0.0	7	931	16	943

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	6.13e-86	12	738	7	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.57e-64	14	578	13	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.75e-43	14	344	44	395	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.94e-43	14	344	18	369	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.24e-43	14	344	48	399	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.93e-42	14	344	44	395	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	1.13e-33	15	392	29	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	2.89e-32	29	578	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.54e-28	17	317	2	296	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q87BR5|NAGZ_XYLFT	4.40e-28	21	305	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_657574-t45_1-p1.