CAZyme Information: K441DRAFT_655599-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_655599-t45_1-p1
• CAZy Family: GH18
• CAZyme Description: glycoside hydrolase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		32292.96	4.2519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748184:2512639-2513754(+)

Full Sequence      

MRFSLVAPLALAVAPSLVSAAGTLGFALGTKNADGSCKDQSDYEADFDAISAASGSTLVR
GYSASDCNSSVAIMPAAKTKGFKVVLGIWPDVQESFDADMDAITAVAPKYASSIYAVTVG
SETLYRGNFTGEQLADKINTVKTALKGVTSTPIKVGTADSWNKFADGTGDAVIGTADLIM
VNAFAFWQGQALSNATNTYFDDVMQAFGHIQSIAGGVDKAPELWNGETGWPTDGGSDFGA
AEAGTSNAASYYKSAICGMLAWDVNLFYFEAFDEPWKPDSIGDNGQPADEKHWGAMTSTR
GTKFSLKC

Enzyme Prediction     

No EC number prediction in K441DRAFT_655599-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	24	308	9.3e-38	0.9967845659163987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.34e-70	7	300	29	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	9.38e-44	24	308	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74265.1|GH17	1.27e-142	1	308	1	304
SMR43216.1|GH17	1.57e-137	1	308	1	305
SMY20536.1|GH17	1.57e-137	1	308	1	305
SMR45377.1|GH17	4.49e-137	1	308	1	305
SMQ46852.1|GH17	4.49e-137	1	308	1	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.46e-31	59	303	69	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.28e-30	59	303	69	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	5.60e-06	161	306	255	383	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	7.05e-117	1	308	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	4.02e-79	1	308	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	5.04e-76	11	308	9	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	4.04e-75	11	308	9	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	4.93e-68	22	308	40	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999771	CS pos: 20-21. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_655599-t45_1-p1.