CAZyme Information: K441DRAFT_653483-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_653483-t45_1-p1
• CAZy Family: GH17
• CAZyme Description: carbohydrate esterase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38364.42	4.9397

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748180:2687863-2689355(+)

Full Sequence      

MMNRLIRLSPLALLTLSACAVPVPEKSSRFSWASTRALIAFGDSYTYVQGTRGYANSTFI
GSQLDLSYTPQELLTDLIVQNQTATAEGGPNWVEYLTGCGLKPGYTSPLKCEPQLWDFAF
GGADISVDFTPLHHNWTISLENQVTQFIGYGNLVLEKFLDKKKTLVAIWIGINDISDSAK
YVVNFPTFYNTLQDRLFSLVSSLYALGYLNFLFFNLPPLNRRPGLVNSANPLPNATMINW
WNDALANHSSLFAQQNPDTNVMLFDTHAVLSGILDESAKYGFVNTTDYCAAYNQPDILTD
PEKYGCLPQDEYFWFNSGHMTSHVHQILAGALEEFLQKESRGK

Enzyme Prediction     

No EC number prediction in K441DRAFT_653483-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	38	332	7.5e-77	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.51e-60	38	335	2	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	4.17e-17	118	332	80	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.71e-12	1	337	1	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	1.21e-07	38	269	1	192	GDSL-like Lipase/Acylhydrolase.
238883	Triacylglycerol_lipase_like	1.78e-07	36	329	2	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08972.1|CE0	1.22e-143	30	339	29	339
BCR96460.1|CE0	1.22e-143	30	339	29	339
QRD91661.1|CE0	4.87e-140	9	337	5	336
UDD64353.1|CE0	4.87e-140	9	337	5	336
QMW35262.1|CE0	5.80e-140	9	337	10	341

PDB Hits     

K441DRAFT_653483-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

K441DRAFT_653483-t45_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000000	1.000047	CS pos: 18-19. Pr: 0.9901

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_653483-t45_1-p1.