CAZyme Information: K441DRAFT_651517-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_651517-t45_1-p1
• CAZy Family: GH17
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577		63301.55	5.8351

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748177:4528944-4530934(-)

Full Sequence      

MVAVREIETDTYDYVVCGGGTAGCVIAGRLAENLNATVLILEAGQNNVDLENVHMPGSWS
NNFDSVTDWNIVTEPMPGVDDRRVKCSRGRFLGGCSGVNGTLCIRGIKQDYDDWEMQGWS
GDEMFKYMAKAETFHGKDRFHASDKDHGYSGPLHTEPHELAPISELVKQSLIDQGLLWHE
DMFTTGETPQGCGNATRTVHQGLRSTAADFITKGYRGDNITIKTDVTVNNVVLSDTAEGL
QASGVSFTLKSGEIGAVKARKEVIVSAGAYCSPAILLRSGIGAKSELEKLGIPCNVDLPG
VGQNLMDHVLAFVFYETEKEGLTNDHLAYHGDGLASSYKLWKEQKTGVLSTFPFGTFAYA
RLDQRLKDDPLWVGSPRRDGRDPMDLTPRQPNLEFWNTELYGGPKQFVDFPINKKHAFAM
CTLLFNARSRGTVSLKSAEPMENPIVDHNYLADPLDLLVLSEGCRYANEIVMNGKGTKDI
IKGSWPPELTHHSYTTREQWVPYVKQQATTCYHAAGTCKMGKADDPSAVLDEKLRVRGVK
GLRVADVSIMPLLNSGHTQMPAYGIGEKAADLIKADA

Enzyme Prediction     

No EC number prediction in K441DRAFT_651517-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	576	1.5e-159	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.06e-100	9	574	3	532	choline dehydrogenase; Validated
225186	BetA	1.71e-97	11	577	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.61e-59	13	573	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.01e-37	428	569	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.61e-25	11	549	55	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48130.1|AA3_2	8.12e-307	10	574	7	571
QMW36070.1|AA3_2	8.12e-307	10	574	7	571
UDD65288.1|AA3_2	3.30e-306	10	574	7	571
QRD92967.1|AA3_2	5.29e-298	10	574	7	580
QRC90540.1|AA3_2	9.54e-297	10	577	13	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	4.56e-75	12	576	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	6.37e-75	12	576	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	8.90e-75	12	576	7	572	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	7.19e-64	12	573	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5NCC_A	2.30e-62	4	577	8	580	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	2.87e-75	9	577	2	531	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.10e-73	8	573	3	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	2.77e-73	11	573	4	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	2.46e-72	7	574	1	533	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	4.69e-72	12	573	5	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000026

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_651517-t45_1-p1.