CAZyme Information: K441DRAFT_651347-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_651347-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: glycosyltransferase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	KV748177|CGC1	53730.54	9.4864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748177:3691926-3693465(+)

Full Sequence      

MSAWKPFSRPSNDPIKSLVLIFVLWKFVLVLLAVASPLPGYDTSSLILTRGHHLHASHRN
FHSEFCTTRERLAINLVRWDAIYFVKAAERGYVNEQEWAFSWVFARLIAFVASYFPSPEH
ALESCIWAGVFISHVSHLLSVLVLHRLFIAVRNETQNSKIAFVGAVLHIISPAGLFLSAP
YGESLFSLLNFSGMLLYVNHHRARQDRSSWDVLQDYYLIGSGCCFALAASIRSNGLLSGL
IFVYDVATLIPPLLRFRLGLNGLRRLVVTVAAGLSIALGFLGPQWLAYEEFCAAATPNRH
VRPWCTNLFPSIYSWAQGHYWDVGFLQYWTLSNVPLFLIAAPMLWLLVQSSFMALSGRLQ
AQALDALPSPRNSVVRQKTLELREISDSSDIERRCLRRLALPQLVLAVTAFASFHVQIIN
RISSGYPIWYLAIAISLVNGTPLHTFDKAQNNASHLVVRWMASYAIIQGGLYASFLPPA

Enzyme Prediction     

No EC number prediction in K441DRAFT_651347-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	19	479	1.1e-102	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.61e-39	15	479	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.49e-16	78	432	76	364	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX94368.1|GT76	5.55e-132	10	479	8	462
CAE7178785.1|GT76	1.74e-128	7	479	7	464
QDS75123.1|GT76	1.65e-127	8	479	6	480
QRC98851.1|GT76	2.90e-125	12	479	9	468
USW52590.1|GT76	1.09e-110	18	479	29	478

PDB Hits     

K441DRAFT_651347-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	1.79e-100	1	479	1	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.58e-87	14	479	29	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	8.09e-86	12	479	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	6.37e-85	11	479	7	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.58e-51	17	479	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.029851	0.970101	CS pos: 35-36. Pr: 0.9288

TMHMM  Annotations     

Start	End
18	40
98	116
126	148
160	182
235	254
266	288
326	348
399	416
426	443
456	478