CAZyme Information: K441DRAFT_649322-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_649322-t45_1-p1
• CAZy Family: GH16
• CAZyme Description: glycoside hydrolase family 55 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		86600.59	5.8917

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748277:115273-118012(-)

Full Sequence      

MMKTTLILVSMLSSFLARAAPTRSLIERATNQSTHVIYFPPLDYSPHPVGIPYTIQNTST
EPWLHLVEPSSPRVNVFATKPTCSSLSPSGSSQFWYEAITHNGQSSFMNSSYKANYKVFR
NVVTDYGADNTGIKDASSAIQSAIAAGATNGPSRSSTSMGTTGQPAVVYIPSGTYLMEDS
IQLYVGTVIIGDPLNPPILKASSNFPNDHIVYGKDPNHDGTINFYIAFKNIIIDSTSVSG
STTITLMDWTVSQATQLTNVVFNMPDNSTGHTGLSTTYGYNSNVILNDLTFYGGVVGMSL
SGQQWVFKNITIISATTGVVAGGTNLVFVGCTFKNVETGINATGISGSLTLIDSTASTLG
SLITSYDSGNAGNSIILENVVNGGNTVTLGSSVVKSGSVTGTWIHGNYYAPGNANARHEK
GHSTTTPRSSVLISNGNYFTMRPPTYQGYSVSQFINIKSVSAYPVYGDGATDDTKNINAI
LSHYADCKIIYFPAGTYIVTNTIIVPAGSRIIGDAYGSAISAVGSNFHNPNAPTTMVQVG
NLGDVGVAQISDMLFTVADALQGCKLVEVNIAGSTPGDVGLWNSHFRIGGAAGSKVQTNC
AGSPDICKAAWGLLHLTNTSSAYIENMWGWTADHDLDGSHGQTISTGRGMLVEATKGTWL
VGTAMEHHTLYQYNFEYASNVFSALQQSETPYWQGPGNDLAPIPWASNLITSDPTFSNCG
TSDATCRMAFFERIRGSSNLFLYGGCVWTFFNNGGSCNGDCQQNAIRVLTSQGNIYLYGT
NVKSVTNLVVSTDTDIATESANAGGWGGVVAAYAYDA

Enzyme Prediction     

No EC number prediction in K441DRAFT_649322-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	89	813	2.2e-218	0.9864864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	4.09e-57	119	341	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.26e-08	454	529	1	76	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	4.96e-04	122	406	84	358	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21782.1|GH55	0.0	15	816	13	821
BCS06656.1|GH55	0.0	38	816	42	818
BCR94046.1|GH55	0.0	38	816	42	818
CAK47731.1|GH55	0.0	38	816	169	944
EAA60087.1|GH55	7.94e-314	13	816	111	933

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	1.28e-97	82	752	10	692	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	5.21e-89	88	753	3	691	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.16e-96	92	753	41	812	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	3.58e-94	94	753	48	716	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.01e-81	164	813	96	760	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999703	CS pos: 28-29. Pr: 0.4242

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_649322-t45_1-p1.