CAZyme Information: K441DRAFT_633987-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_633987-t45_1-p1
• CAZy Family: GH15
• CAZyme Description: iron reductase domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	KV748190|CGC1	53932.92	8.2424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748190:2580274-2582025(-)

Full Sequence      

MKSILSAALLGLVSRASAQVATACITSDVCYGLNIPADTASSGNGDVFFQISAPSTYQWV
ALGQGTGMTGSNIFVVYTSSDGKNVTLSPRLGTGHAEPKFNSKAEVSLLDGSGISNGKMV
ANIKCSNCQSWSGGSMDFTSSSGKWIHGFKSGGALNSDDTSATISQHGNGDASTFSWDFT
NAKGGNSVNPFTAVSASGSGTVAGATGTSSCVPRPTTGTFANAAATTTWPSTIPSEFASA
FPTNFPSEWQSRWPTAKPTGSYSWNKRDEVNYCDSSSNVNNGNGNAFTVLSLLTRETKML
IAHGVMAALAFVILFPVGAISIRLLSFPGLVWFHAAFQAFAYLVFLVAFGLGVSIANTEG
VLTEYHPIIGIVLFVAIFFQPIFGFLHHSLYKKHNSRTLWSYVHIWLGRIVITLGIINGG
LGFMLADTMGAGSHTGMIVYSVVAAIVWLVYVLAIVLGERRRARMAHDSPPKYSETSYDT
PPAPINPPAERAESPGAQGYYSGGHNGPKNQ

Enzyme Prediction     

No EC number prediction in K441DRAFT_633987-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	27	183	7.2e-19	0.8681318681318682

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187688	CDH_like_cytochrome	3.30e-52	26	179	18	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
176490	Cyt_b561_FRRS1_like	1.84e-41	298	456	34	191	Eukaryotic cytochrome b(561), including the FRRS1 gene product. Cytochrome b(561), as found in eukaryotes, similar to and including the human FRRS1 gene product (ferric-chelate reductase 1), also called SDR-2 (stromal cell-derived receptor 2). This family comprises a variety of domain architectures, many of which contain dopamine beta-monooxygenase (DOMON) domains. The protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
406418	CDH-cyt	1.99e-28	26	183	17	174	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
214769	B561	8.28e-18	303	423	2	129	Cytochrome b-561 / ferric reductase transmembrane domain. Cytochrome b-561 recycles ascorbate for the generation of norepinephrine by dopamine-beta-hydroxylase in the chromaffin vesicles of the adrenal gland. It is a transmembrane heme protein with the two heme groups being bound to conserved histidine residues. A cytochrome b-561 homologue, termed Dcytb, is an iron-regulated ferric reductase in the duodenal mucosa. Other homologues of these are also likely to be ferric reductases. SDR2 is proposed to be important in regulating the metabolism of iron in the onset of neurodegenerative disorders.
176491	Cyt_b561_CYB561D2_like	7.17e-06	303	452	24	183	Eukaryotic cytochrome b(561), including the CYB561D2 gene product. Cytochrome b(561), as found in eukaryotes, similar to and including the human CYB561D2 gene product. CYB561D2 is a candidate tumor suppressor. The protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7013938.1|AA8	2.11e-130	9	466	11	388
SMR42136.1|AA0	4.52e-107	8	470	9	393
SMR44317.1|AA0	4.52e-107	8	470	9	393
SMR55355.1|AA0	5.49e-99	29	479	25	382
SMR57731.1|AA0	5.49e-99	29	479	25	382

PDB Hits     

K441DRAFT_633987-t45_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M363|B561I_ARATH	2.09e-13	294	483	215	393	Cytochrome b561 and DOMON domain-containing protein At3g61750 OS=Arabidopsis thaliana OX=3702 GN=At3g61750 PE=3 SV=1
sp|O80854|B561L_ARATH	3.24e-09	303	418	56	175	Cytochrome b561 domain-containing protein At2g30890 OS=Arabidopsis thaliana OX=3702 GN=At2g30890 PE=2 SV=1
sp|Q9LSE7|B561C_ARATH	8.06e-09	303	463	220	384	Cytochrome b561 and DOMON domain-containing protein At3g25290 OS=Arabidopsis thaliana OX=3702 GN=At3g25290 PE=2 SV=1
sp|Q9LYS9|B561H_ARATH	2.03e-06	303	465	220	383	Cytochrome b561 and DOMON domain-containing protein At3g59070 OS=Arabidopsis thaliana OX=3702 GN=At3g59070 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999692	CS pos: 18-19. Pr: 0.9162

TMHMM  Annotations     

Start	End
300	322
331	353
368	390
403	425
435	457