CAZyme Information: K441DRAFT_629316-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_629316-t45_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	KV748182|CGC1	90233.79	8.2539

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748182:1959246-1961670(-)

Full Sequence      

MXRESSRRDHTRHEPRDRDRDRDHDRDRDRERERQRRRRGHRATDSTGELLPPVTRTPRD
SASESPSPRKVRGSDRTNGSRSNPLSLGSLAKLDSQNLKRGWKGYDYDSEYVKEVRQKEA
RMEKERLREEALERKRERERDRERRRAYESDNAQQEHERVTVERREEEKKRRRHADDETK
ERRKRYTESERAERRERRKAQREIPANQRRRVVSGPLLEEGGKDEVHEYMAEKTGGAGSD
GYTDEEWARRKRKRICIIVGVIILILTIVIVVAVLMSKKNSDPVESKAAASSQKPSNSNL
NGVSESSIPSSAQGTVLDPFTWYDTTDFNVTYTDATVGSLSIMGLNSTWDDSVQANSNVP
ALKDSFNYGTTPIRGMNVGGWLSIEPFITPSFFSGFSTHDGVIDEYTLTSKLGSTKAAQT
LEKHYASFATRQTFEDIRAAGFDHVRIPFSYWAITTYQGDPYVPKISWRYLLRGIEYARQ
NGLRINLDLHGAPGSQNGWNHSGRQGYIGWLNGTDGDLNAQRTLDIHGQLSTFFAQPRYK
NVVTMYGLVNEPRMVALDTQSVLNWTGKAIDIVRKNNITAVIVFGDGFMGLDNWQGKLQN
YDNLLLDVHQYVIFNTDQIALKHTDKLTFACKGWTTQTLRSQNKATGFGPTMCGEWSQAD
TDCTQYINNVGVGSRWEGTMNTGSASTSVLDPTCPTQNNPACECTDANADPSKYSAAYKQ
WLQQFAEAQMESFEQGWGWFYWTWETEAATQWSWKLGMAAGILPSKAYDRNFNCNNTIPD
YEQLGLPENY

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	423	747	1.3e-105	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.32e-42	367	777	12	397	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.37e-10	427	668	23	250	Cellulase (glycosyl hydrolase family 5).
381626	GH113_mannanase-like	0.004	425	502	16	96	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO11174.1|GH5_9	1.79e-278	292	790	275	776
QIX01616.1|GH5_9	8.54e-275	294	790	268	769
SMY19701.1|GH5_9	1.10e-265	292	790	260	761
SMQ46023.1|GH5_9	1.26e-264	292	790	260	761
SMR42369.1|GH5_9	2.53e-264	292	790	260	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H4P_A	1.35e-62	372	772	12	399	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	1.79e-62	365	772	1	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.43e-62	365	772	1	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.02e-62	365	772	7	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	7.51e-62	365	772	6	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CTI3|EXGD_ASPCL	1.51e-219	295	790	342	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1
sp|A2QX52|EXGD_ASPNC	1.23e-215	296	790	343	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgD PE=3 SV=1
sp|Q4WMP0|EXGD_ASPFU	6.11e-214	282	790	335	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	6.11e-214	282	790	335	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|Q0CHZ8|EXGD_ASPTN	1.14e-212	295	790	349	838	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

Start	End
255	277