CAZyme Information: K441DRAFT_611568-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_611568-t45_1-p1
• CAZy Family: CE9
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		63563.67	8.7188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748198:282736-284669(-)

Full Sequence      

MICTHVIQVIIGGGTAGLTVAARLAENSITTVAVIEAGDFADIAGNLSTVPGYGWKVSTP
QLDWGFTTTPQASMADRSLIYSRGKAIGGSSVTNLQAYHRGTVQSFDRWAQVVGDNSFTF
KNMLQWYKKSVKYTPPDNVVRAANASIPALSPQAYSKSGGPLHVTYSNWANPASSYGPAA
WKELGVSELNDLLSGQLIGNQYSPANIQPATQTRDTSQTSFLKYALNSGRNNIKLYKTSL
AKRVLFNTSSKNPTATGVTVRTNEQTYTLHAKKEVIISAGALQAPQILMVSGVGPKSTLQ
SLGIPVIADRPGVGRNMQDHMFVSLVYQVATVTESSLSIPENNDKANSDFNEKHQGILTN
TGADHFGWEKLPSSYLDKLDNSTRAYLASFPSDWPDYELVIGDLPFTPSGSYSGDYIQGI
IMLQSPESRGSISISSNNTSDPPLIDTKTLTSAKDRAILVQAFHRVREFFETKSMKSVII
GNEVVPGNGTETDEQILSYLEQNGGPGFHAACTCSMGKTSDPNAVVDTQGRVIGVKNLRV
VDASVFPLLPPGHLVSTVCKFSQSIVDQLVRFPAKSSFSPLRRCGGEARK

Enzyme Prediction     

No EC number prediction in K441DRAFT_611568-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	567	5e-165	0.9806338028169014

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.54e-83	9	554	9	516	choline dehydrogenase; Validated
225186	BetA	6.15e-77	9	558	11	522	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.27e-30	426	558	1	136	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.51e-20	77	321	17	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.35e-18	9	546	59	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ37565.1|AA3_2	7.04e-168	9	571	37	598
AUS76865.1|AA3_2	4.53e-158	9	570	47	611
QIW98368.1|AA3_2	2.77e-153	9	570	47	619
UJO15235.1|AA3_2	3.87e-151	9	570	46	622
QSZ31585.1|AA3_2	5.45e-150	9	565	47	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.40e-55	9	567	9	580	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	5.77e-55	9	553	5	545	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.87e-55	9	553	6	546	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.00e-52	9	563	44	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	1.50e-51	9	577	9	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.93e-146	9	565	54	620	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	4.32e-145	10	569	56	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	8.07e-135	9	570	39	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.61e-134	9	567	44	605	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	2.28e-130	9	570	78	640	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999242	0.000767

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_611568-t45_1-p1.