CAZyme Information: K441DRAFT_605605-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_605605-t45_1-p1
• CAZy Family: CE4
• CAZyme Description: glycoside hydrolase family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1012		111129.95	6.9051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748184:2343334-2350299(+)

Full Sequence      

MYGRTTRNCKYMKLSFKFLSSVVLSCLTIESAARTVGGKPKRWIQPYKRAPLQDIVTWDE
DSLFVRGERIFWYSGEFHPFRLPVVSLYLDVFQKIKAMGYNGVSFYVHWALLEGKPGEFS
ADGVFALEPFFDAASKAGIYLLARPGPYINAEASGGGFPGWLQRVNGTLRTADPAYLNAT
ALYVESIGKIVSKAQITNGGPVILLQPENEYSGAMPNVKFPDPVYFGYVEEQYRKAGIVV
PFINNDARTAGYFTPGSESAVDIYGHDGYPLGFDCAHPYTWPNGALPTGWRATHLKQSPS
TPYAIVEFQGGSFDPWGGLGFDQCSVLLSNEFERVFYKNDYSFGVTIFNLYMTYGGTNWG
NLGHPGGYTSYDYGAVISEERLITREKYSEQKLEANFFKVSPAYLTADRGNASNTSWTTS
TDLTVTPAFSNSTKLYFLRHAAYNSLDSTRYKLHVQTAIFGNLTVPQLNGTLTLNGRDSK
IHISDYDIGGVNIVYSTAEVFTWKKYSSKIVLIVYGGPNKQHEIAIQASSATVVEGSGAT
IVQKEGYSIINWNSNPERKIIKVDSNVYIYLLDRNSAYNYWAVDLTPYSSASSVIVKAGY
LLRSAKVKGSTLALTGDLNATTLIEVIGGAPKSLSKLTFNGVSLPFKAGDYIVYTATADF
EEPKFTLPDLSALNWKYLDSLPEIQSPYSDTAWASANLKTTYNTLRPLTTPTSLYGSDYG
YNTGTLLFRGHFTATGAETSLFLWTQGGSAFGTSAWLNSDFIGSWDGIDAATNSNTTFTF
PNLTPGKSYVFTIVIDNMGLDENWVVGSETMKNPRGILNYTLSGRPQSAITWKLTGNLGG
ESYADHSRGPLNEGGMYAERQGYHLPSAPTKSWKDSTGPTAGISTAGIGFFTTSFDLDMP
KGYDIPLSFVFTNSSTSAAGNSSLATAYRVQLFVNGWQFGKYVHNVGPQTKFPVPEGIFD
YHGSNYVAVTLWALEKEGAKVEGLKLAVDAVTGFGEVETVEGQKWVKRKGAY

Enzyme Prediction     

EC	3.2.1.23:18	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	63	392	1.4e-86	0.9804560260586319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	9.93e-99	62	393	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	5.53e-64	406	579	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.48e-48	404	580	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	3.53e-33	857	977	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	7.51e-27	688	801	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX92575.1|GH35	0.0	12	1012	1	1007
CAE7010395.1|GH35	0.0	15	1012	3	1010
QRD00169.1|GH35	0.0	19	1012	5	1003
UJO21024.1|GH35	0.0	17	1012	5	1011
UPP54610.1|GH35	0.0	44	1012	35	1009

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IUG_A	0.0	17	1012	2	1005	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	0.0	37	1012	7	1003	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
1TG7_A	0.0	52	1012	2	971	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFT_A	0.0	46	1012	36	1007	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
5IFP_A	0.0	46	1012	36	1007	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8QGZ3|BGALA_PENEN	0.0	17	1012	2	1011	Probable beta-galactosidase A OS=Penicillium expansum OX=27334 GN=lacA PE=2 SV=1
sp|Q2UCU3|BGALA_ASPOR	0.0	17	1012	2	1005	Beta-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacA PE=1 SV=1
sp|P29853|BGAL_ASPNG	0.0	46	1012	36	1006	Beta-galactosidase OS=Aspergillus niger OX=5061 GN=lacA PE=1 SV=2
sp|Q4WG05|BGALE_ASPFU	0.0	48	1012	34	1011	Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacE PE=3 SV=1
sp|B8N6V7|BGALA_ASPFN	0.0	17	1012	2	1005	Probable beta-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009157	0.990808	CS pos: 33-34. Pr: 0.6275

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_605605-t45_1-p1.