CAZyme Information: K441DRAFT_603555-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_603555-t45_1-p1
• CAZy Family: CE4
• CAZyme Description: glycoside hydrolase family 63 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815	KV748181|CGC2	92749.93	4.8744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748181:866474-869365(-)

Full Sequence      

MELLSQWQILLTLFLTLLPQAGAEVDAATAVVEIEKASNDSLLWGPYRPNLYFGVRPRIP
KSLLTGLLWARVEDFQSVQHDFRHTCEQHELDGYGWDEYDIRTGGRQTIHDPSNRIDLTT
EFVKVPGGQHGGNWGVRIKGSPRDDASPDLKTTIVWYAALEGLGSLEVKSQDGDDLGIEG
DVKLEGQTVDLGDFDIRITAGEGEHPRPMHPSYAEKPLDRTIVHSFQLPEEALWQTKPIL
FAHMKSQIDTLLGKYGEDNAPPPAQVYTISNEPGRGNLHMVQKVFEGAFEFDILFSSGSS
PKPMASDDLGQQIKSVAQSFSSRFSDIFKPKSPFLKGRYEEFSKSLFSNLIGGIGYFYGD
SRVDRSYAPEYEEDNEGFWEEAAEARGRNQAQLEGPSELFTSIPSRSFFPRGFLWDEGFH
LLPIIDWDVDLTLDIVKSWFSLTDEDGWIGREQILGAEARSKVPPEFQVQYPHYANPPTL
FMVLTAFLDKLDDNTQTYSSSEQKALGKEYTRHLSNRSAALQYLRTLYPLLKRHYFWFRK
TQSGDIKSYDRAAFSTKEAYRWRGRTPQHVLTSGLDDYPRAQPPHPGELHVDLISWMGLM
TRSLKRIADALGEDDDKAELERYETAILRNIDDLHWDDRAKTYCDATIDDYEESVHVCHK
GYISIFPFLVGLLPADSPKLNAVLDLIADPEELWSEHGLRSLSKSDEFYGTGENYWRGPI
WVNMNYLAVVQLLNLAQTSGPHQKRATKIYTELRENIVNTVYEAWIETGFAWEQYNPETG
KGQRTQHFTGWTSLVVNIMAMPDLANGKRRVRDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	587	799	1.4e-32	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	304	801	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.15e-123	42	262	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	5.56e-09	515	749	352	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	3.06e-04	591	793	578	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC96601.1|GH63	0.0	10	815	14	810
CAE7194739.1|GH63	0.0	31	815	30	813
CBX90523.1|GH63	0.0	31	815	29	810
KAF2710732.1|GH63	0.0	31	733	26	727
AAR23808.1|GH63	0.0	20	815	23	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.96e-184	33	799	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	6.81e-142	42	800	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	2.23e-255	30	800	30	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.77e-184	15	799	18	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.12e-143	42	800	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	5.99e-140	42	800	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	2.51e-137	44	800	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001860	0.998103	CS pos: 23-24. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_603555-t45_1-p1.