CAZyme Information: K441DRAFT_591808-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_591808-t45_1-p1
• CAZy Family: AA9
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828	KV748253|CGC1	91654.55	6.3055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748253:85026-87666(-)

Full Sequence      

MADIDVEKVLSELTIAEKCDITAGRDFAHTFPIPRLGIPALRTSDGPNTVRGTRFFNSTP
TICLPAGPALAATWNRALLQEIGGLLADESIAKGSHVLLGPCINIPRSPLGGRGHEAFGE
DPMLAGVLAGHMCRGMQEKGIIATPKHFLCSDQEQGCFSMNCIVTERALREIYLMPFMLA
IKIGDPGAIMAAYNKINGVHVTEDRRILHQILRQEWGFRGLVISDWHGLYATTAPVRAGL
DLEMPGPNQWRGRSLAHSLLADRLTIRALDDCVRNVLKLVKEAARPKIPANALEQPLNRE
QDRQLLRRAAAESIVLMKNTCKALPLDPTKPIAVIGPNAAIAAYRGGRIAHLRPYYTVSP
LEAIRQRSEAEVAFAQGIYNHKERPLLGHQLRTSSGELGFDMYIYTEPPTVTDRKPVDHY
EFLNSCGYFLNYEHSDRIDGENWHINIEGRLTATRSGTYEFGVSVQGTASLYVDGKLVVD
NTTNQTFGEGFFRAGTVEVVGTVDLVEGQTYNVVVNWAGAHTSELIRNSPLTFHPGGIRL
GGCMQIDVDASITAAEQLAGQFDQVVVLAGLMGDWENEGADRPNIDLPEHTNHLITRVLD
ANPKAVICISSGSPVVMPWADKATTLLHVWYGGNETGNAISDVLYGDVNPSGKLPLSFPI
HLRDNPAYLYSRAERHRLLYGEDVFVGYRFYDTMEKDVLFPFGHGLSYTRFALSDLALSV
DGTGDHVANVGEYDGSETVQVYIQPQAPSVNRPVRELKGFEKVAVPKQKKTMIRIPMELK
YAMAFWDEAEDRWVCEKGVYMVLVGTSSRGKFLEERFEVERTFWWQGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	1.8e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.49e-76	35	818	101	763	beta-glucosidase BglX.
224389	BglX	1.25e-67	33	339	55	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.37e-45	526	688	52	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.80e-41	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.46e-32	9	775	56	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK49185.1|GH3	5.20e-308	1	828	17	846
BCS12335.1|GH3	1.04e-307	1	828	17	846
BCS00565.1|GH3	1.04e-307	1	828	17	846
BCS04055.1|GH3	2.02e-303	1	828	1	839
BCS15658.1|GH3	2.02e-303	1	828	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.50e-232	1	828	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.04e-226	5	828	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.66e-128	4	822	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.64e-103	10	809	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.62e-97	6	823	4	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	1.40e-308	1	828	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	6.94e-304	1	828	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.39e-303	1	828	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	5.63e-303	1	828	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.35e-302	1	828	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999961	0.000082

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_591808-t45_1-p1.