CAZyme Information: K441DRAFT_562813-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_562813-t45_1-p1
• CAZy Family: AA5
• CAZyme Description: glycoside hydrolase family 29 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502	KV748199|CGC2	55446.18	4.3410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748199:1927878-1929553(-)

Full Sequence      

MKCSFLLLGACVVNLALASATTVSSSIAAFPTPKYRISPLDGSIIALPTREQLDFQDKEF
GVLIHFEMGTYLDIDGCNNVPSLVPNLTLFDPALLNTDQWMDSITALGAKYATLVAKHNC
GFTTWPSQVKFQTRDNTTISYNYTIAQSPVAGEDVVKSFIDSAKKYGIGYGLYYSTVVNN
FLNVQQSEVNATSWAVGQVRISNETYDEIVVAQLTELWTNYRSLTEIWFDGGYSTTQQIV
YADLLAELQPKAVIFNACDVMTGECLTENSVRWVGTESGEAPIENWSTGTTNDGGNSTSP
YFCPAVCDTTLQTDDRWFYGVDQPLRSIEELIAVYHVSVGRNCLLELDLSPNRSGLIPGR
HAARYKQLGDFISSCYSSPVNAPHTQNSSNDGTYTLKFDYATSIDRIMLMEDQTNGQVIR
SYRVWAKVINDGVTDGTLDVPWTEVSNGTSIGHKKIDIFDEAITVTEVLVNTTFVDTPVW
RSASVHLCGQMFANTTGWEFTP

Enzyme Prediction     

No EC number prediction in K441DRAFT_562813-t45_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	50	373	2.4e-48	0.861271676300578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226195	AfuC	1.52e-25	43	473	6	416	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
395889	Alpha_L_fucos	3.60e-22	48	371	8	327	Alpha-L-fucosidase.
214829	Alpha_L_fucos	1.72e-18	88	419	79	380	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23119.1|GH29	6.85e-223	18	494	9	492
ATY67468.1|GH29	7.23e-193	34	488	32	475
UJR12650.1|GH29	1.01e-145	31	488	31	479
UJR24945.1|GH29	1.77e-141	31	488	32	480
UJR24914.1|GH29	1.39e-135	34	488	33	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GZA_A	8.44e-46	45	460	7	414	Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482],3GZA_B Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	1.21e-33	30	455	14	427	Crystal structure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	1.46e-29	47	494	38	471	Crystal structure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	9.63e-28	47	367	9	317	Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	1.31e-25	48	461	19	451	Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8GW72|FUCO1_ARATH	3.62e-35	37	456	27	446	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
sp|Q7XUR3|FUCO1_ORYSJ	5.26e-32	6	456	6	446	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
sp|P49713|FUCO_CAEEL	2.67e-06	55	373	34	343	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999658	CS pos: 18-19. Pr: 0.9834

TMHMM  Annotations     

Start	End
5	27