CAZyme Information: K441DRAFT_557119-t45_1-p1

Basic Information

• Species: Cenococcum geophilum
• Lineage: Ascomycota; Dothideomycetes; ; Gloniaceae; Cenococcum; Cenococcum geophilum
• CAZyme ID: K441DRAFT_557119-t45_1-p1
• CAZy Family: AA4
• CAZyme Description: glycoside hydrolase family 79 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		56867.86	4.7823

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Cgeophilum1.58	14745	794803	38	14707

• Gene Location: location=KV748192:1407460-1409174(-)

Full Sequence      

MALLRSLLVATVLSTALSAVAHAQNAIPVNPTPSNAGGPLLQSFVSYSIEFAFFPDYAGN
ASYPNDFSNNLLESISAFSGTKPYIRVGGNTQDYALYDASLKVATNGTYIPSISKDYPLI
LSIGPSYFESYSTWPNTKFIHGFNLAKNTTDDRVKLLDTVPLVCKALGGGKLLYWELGNE
PDLYKTSAQGHVRPPTWTESDYVSEWLNVTGKIGESMAKSCTEMATSSEYQYIAPSLAGT
NNSLKPLTIWKDNLDTADDIALFSSHNYIGGATQPGVTLQGTLMNHTSTVVSVSKQIDEA
NALAQAGMTLPFILGETNSLYNEGAPGLSNAFGAALWGVDFNLYCAATGIKRVHMHQGTN
YRYASWQPVDTSATTKGTKPPYYGNIAVAATLGDLTVDQVQVQHLPLPEDTEAAYAVYAN
STLARVMVINMVQYNYSAATVDDRPAVTYNFTVPTSCAGVGVVQRLMANGSDAITGITFN
GHSYNYELDLGKPWLVGNVTKDEITWVGEDGTFGVKVPYSSAALVQLSC

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	43	493	1.6e-86	0.9274725274725275

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	2.30e-27	414	524	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96418.1|GH79|3.2.1.-|3.2.1.31	2.88e-220	33	527	42	541
QKX60609.1|GH79	4.54e-219	12	527	10	526
BCR93948.1|GH79	1.26e-216	33	527	42	541
BCS06559.1|GH79	1.26e-216	33	527	42	541
ATZ50670.1|GH79	6.54e-199	22	526	17	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	9.47e-31	27	527	7	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	7.98e-23	23	528	9	475	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	8.72e-23	23	528	9	475	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	2.19e-22	23	528	29	495	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	5.67e-18	85	528	64	446	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	5.12e-221	33	527	42	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	8.62e-187	25	526	18	557	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999741	CS pos: 23-24. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in K441DRAFT_557119-t45_1-p1.